BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0613 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 3.6 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 22 4.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.7 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 6.3 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 6.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.3 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 606 DKQRTPRATHDNR 644 D+ RTPR HD R Sbjct: 210 DESRTPRPKHDGR 222 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 7/30 (23%) Frame = +2 Query: 371 TGHIARNCPEGGR-------ESATQTCYNC 439 +G + NCP GG+ E+A + C +C Sbjct: 19 SGCLITNCPRGGKRSKFAISENAVKPCVSC 48 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 Query: 202 ESRDTTPPCVHSRAKCPVRLH 140 E R+ PP VHS P H Sbjct: 1790 EEREEAPPSVHSSTVVPPPQH 1810 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 366 TRRATSHGTVPR 401 TRRA+S G +PR Sbjct: 268 TRRASSRGIIPR 279 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 392 CPEG-GRESATQTC---YNCNKSGHISRNCPDG 478 CPE G + + C Y CN + CPDG Sbjct: 39 CPEKYGFFADAEQCDKYYECNDGQITEKLCPDG 71 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 349 VMLQLQQDGP 378 VMLQ+ QDGP Sbjct: 964 VMLQISQDGP 973 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 349 VMLQLQQDGP 378 VMLQ+ QDGP Sbjct: 964 VMLQISQDGP 973 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,834 Number of Sequences: 336 Number of extensions: 3736 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -