BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0609 (823 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 51 8e-07 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 50 2e-06 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 50 2e-06 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 48 1e-05 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 46 3e-05 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 45 5e-05 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 45 5e-05 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 45 5e-05 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 44 2e-04 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 42 7e-04 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 40 0.002 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 40 0.002 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 40 0.002 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 40 0.003 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 40 0.003 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 38 0.008 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 37 0.014 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 36 0.025 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 35 0.075 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 35 0.075 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 34 0.099 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 33 0.30 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 32 0.40 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 0.92 At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS... 31 0.92 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 31 0.92 At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS... 30 1.6 At1g61140.1 68414.m06888 SNF2 domain-containing protein / helica... 30 1.6 At5g06750.1 68418.m00763 protein phosphatase 2C family protein /... 29 2.8 At4g24550.2 68417.m03519 clathrin adaptor complexes medium subun... 29 2.8 At4g24550.1 68417.m03518 clathrin adaptor complexes medium subun... 29 2.8 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 29 2.8 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 29 2.8 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 29 2.8 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 29 3.7 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 29 4.9 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 29 4.9 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 29 4.9 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 28 6.5 At4g36830.1 68417.m05223 GNS1/SUR4 membrane family protein weak ... 28 6.5 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 28 6.5 At1g69730.1 68414.m08024 protein kinase family protein contains ... 28 6.5 At5g13680.1 68418.m01593 IKI3 family protein weak similarity to ... 28 8.6 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 51.2 bits (117), Expect = 8e-07 Identities = 23/86 (26%), Positives = 47/86 (54%), Gaps = 2/86 (2%) Frame = +1 Query: 268 VAKVDCTRFTAVASHFHIRAYPTI-LFLKGSFQHEYTGDRVKEDLINYAMRMSQPAVQRI 444 +AK+D T +A + I+ +PT+ LF+ G + Y G+R K+ ++ + + + P++ I Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 445 SRGNSIEYLKESHP-VFFGFIGNRKG 519 + E + + P + FGF+ + G Sbjct: 211 TTKEEAERVLSAEPKLVFGFLNSLVG 236 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 137 DRFLEF-SKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 D F EF + V+FYAPWC C+ + P +A A L Sbjct: 107 DNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145 Score = 34.3 bits (75), Expect = 0.099 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 L+ SKD + ++ YAPWC HC+ EP + + + L Sbjct: 452 LDESKDVL--LEIYAPWCGHCQSFEPIYNKLGKYL 484 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 50.0 bits (114), Expect = 2e-06 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 1/97 (1%) Frame = +1 Query: 232 ACGTSLVYTPVKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQHEYTGDRVKEDLINYA 411 A T L V +AK+D T +A + ++ +PT+LF YTG R KE ++ + Sbjct: 144 AAATELKEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWV 203 Query: 412 MRMSQPAVQRISRGNSIE-YLKESHPVFFGFIGNRKG 519 + P V ++ + E L + V G++ + G Sbjct: 204 KKKIGPGVYNLTTLDDAEKVLTSGNKVVLGYLNSLVG 240 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQAL 250 V+FYAPWC HC+ + P +A A L Sbjct: 125 VEFYAPWCGHCQSLAPEYAAAATEL 149 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 L+ SKD + ++ YAPWC HC+ +EP + +A+ L Sbjct: 456 LDDSKDVL--LEVYAPWCGHCQALEPMYNKLAKHL 488 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 50.0 bits (114), Expect = 2e-06 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 1/97 (1%) Frame = +1 Query: 232 ACGTSLVYTPVKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQHEYTGDRVKEDLINYA 411 A T L V +AK+D T +A + ++ +PT+LF YTG R KE ++ + Sbjct: 144 AAATELKEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWV 203 Query: 412 MRMSQPAVQRISRGNSIE-YLKESHPVFFGFIGNRKG 519 + P V ++ + E L + V G++ + G Sbjct: 204 KKKIGPGVYNLTTLDDAEKVLTSGNKVVLGYLNSLVG 240 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQAL 250 V+FYAPWC HC+ + P +A A L Sbjct: 125 VEFYAPWCGHCQSLAPEYAAAATEL 149 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 L+ SKD + ++ YAPWC HC+ +EP + +A+ L Sbjct: 456 LDDSKDVL--LEVYAPWCGHCQALEPMYNKLAKHL 488 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = +2 Query: 110 SSSRVLELSDRFLE---FSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 SSS VL+L+ + + +G+ V+F+APWC HC+ + PTW VA L Sbjct: 26 SSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75 Score = 46.0 bits (104), Expect = 3e-05 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 137 DRFLEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 D + SK+ +W V+F+APWC HC+++ P W A L Sbjct: 174 DELVTESKE-LWIVEFFAPWCGHCKKLAPEWKKAANNL 210 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = +2 Query: 110 SSSRVLELSDRFLE---FSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 SSS V++L+ + + +G+ V+F+APWC HC+ + PTW VA L Sbjct: 28 SSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77 Score = 46.0 bits (104), Expect = 3e-05 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 L + +W V+F+APWC HC+++ P W A+ L Sbjct: 175 LVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL 209 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +2 Query: 134 SDRFLEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 SD+ E KD WFVKF PWC HC+++ W + +A+ Sbjct: 36 SDKIKE--KDTAWFVKFCVPWCKHCKKLGNLWEDLGKAM 72 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPT-ILFLKGSFQHEYTGDRVKEDLINYAMRMSQPAVQ 438 ++V +VDC AV + I +YPT +LF G +Y G R E L + + ++ A + Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEETEKAAE 137 Query: 439 R 441 + Sbjct: 138 K 138 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +2 Query: 134 SDRFLEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 SD+ E KD WFVKF PWC HC+++ W + +A+ Sbjct: 36 SDKIKE--KDTAWFVKFCVPWCKHCKKLGNLWEDLGKAM 72 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPT-ILFLKGSFQHEYTGDRVKEDLINYAMRMSQPAVQ 438 ++V +VDC AV + I +YPT +LF G +Y G R E L + + ++ A + Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEETEKAAE 137 Query: 439 R 441 + Sbjct: 138 K 138 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +2 Query: 134 SDRFLEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 SD+ E KD WFVKF PWC HC+++ W + +A+ Sbjct: 36 SDKIKE--KDTAWFVKFCVPWCKHCKKLGNLWEDLGKAM 72 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPT-ILFLKGSFQHEYTGDRVKEDLINYAMRMSQPAVQ 438 ++V +VDC AV + I +YPT +LF G +Y G R E L + + ++ A + Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEETEKAAE 137 Query: 439 R 441 + Sbjct: 138 K 138 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 4/85 (4%) Frame = +1 Query: 259 PVKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQHEYTGDRVKEDLINYAMRMSQPAVQ 438 P+ +AK++ +++ +A I A+PT++ EY G R + L+ Y + P V Sbjct: 84 PIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVA 143 Query: 439 RISRGNSI-EYLKES---HPVFFGF 501 + +++ E+++++ PVF GF Sbjct: 144 VLESDSTVKEFVEDAGTFFPVFIGF 168 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +2 Query: 122 VLELSDRFLE--FSKDGMWFVKFYAPWCSHCRRMEP 223 VLEL+D + S FV FYAPWC HC+R+ P Sbjct: 34 VLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNP 69 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQHEYTGDRVKEDLINYAMRMSQPAVQR 441 V +AK+D R++ VAS I+ +PT+L YTG E+++ + + + + + Sbjct: 128 VLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGASTIK 187 Query: 442 ISRGNSIE-YLKESHPVFFG 498 + + +LK+ H G Sbjct: 188 LDTVDEASGFLKKHHTFILG 207 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 71 GLYIIFFTRIFNVSSSRVLELSDRF-LEFSKDGMWFVKFYAPWCSHCRRMEPTW 229 G ++ + V+ V+ D F E KD V+FYAPWC HC+++ P + Sbjct: 9 GFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVA 241 L+ +KD + V+FYAPWC HC+ + PT+ VA Sbjct: 156 LDQNKDVL--VEFYAPWCGHCKSLAPTYEKVA 185 Score = 36.7 bits (81), Expect = 0.019 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTI-LFLKGSFQ-HEYTGDRVKEDLINY 408 V +AKVDC +V + + + YPTI F KGS + +Y G R E L Y Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEY 125 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 71 GLYIIFFTRIFNVSSSRVLELSDRF-LEFSKDGMWFVKFYAPWCSHCRRMEPTW 229 G ++ + V+ V+ D F E KD V+FYAPWC HC+++ P + Sbjct: 9 GFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVA 241 L+ +KD + V+FYAPWC HC+ + PT+ VA Sbjct: 156 LDQNKDVL--VEFYAPWCGHCKSLAPTYEKVA 185 Score = 36.7 bits (81), Expect = 0.019 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTI-LFLKGSFQ-HEYTGDRVKEDLINY 408 V +AKVDC +V + + + YPTI F KGS + +Y G R E L Y Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEY 125 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQHE-YTGDRVKEDLINYAMRMSQ 426 V +AK+D T + F ++ +PTI F S Y GDR KED IN+ + S+ Sbjct: 425 VIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSE 480 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 155 SKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 SK V+FYAPWC HC+++ P + A L Sbjct: 44 SKHDFIVVEFYAPWCGHCQKLAPEYEKAASEL 75 Score = 35.9 bits (79), Expect = 0.032 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVA 241 ++FYAPWC HC+++ P VA Sbjct: 395 IEFYAPWCGHCQKLAPILDEVA 416 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.5 bits (88), Expect = 0.003 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQAL 250 V+FYAPWC HC+++ P + A AL Sbjct: 52 VEFYAPWCGHCKQLAPEYEKAASAL 76 Score = 35.1 bits (77), Expect = 0.057 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVA 241 ++FYAPWC HC+++ P VA Sbjct: 397 LEFYAPWCGHCQKLAPILDEVA 418 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQ-HEYTGDRVKEDL 399 V +AK+D T F ++ +PTI F S Y GDR +E L Sbjct: 427 VVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESL 473 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.5 bits (88), Expect = 0.003 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQAL 250 V+FYAPWC HC+++ P + A AL Sbjct: 52 VEFYAPWCGHCKQLAPEYEKAASAL 76 Score = 35.5 bits (78), Expect = 0.043 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQ-HEYTGDRVKEDLINY 408 V +AK+D T F ++ +PTI F S Y GDR KED I++ Sbjct: 427 VVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISF 476 Score = 35.1 bits (77), Expect = 0.057 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVA 241 ++FYAPWC HC+++ P VA Sbjct: 397 LEFYAPWCGHCQKLAPILDEVA 418 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 1/87 (1%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTILFLKGSFQHEYTGDRVKEDLINYAMRMS-QPAVQ 438 V +AK+D R++ +AS I+ +PT+L Y G ED++ + + + P + Sbjct: 130 VLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPIIT 189 Query: 439 RISRGNSIEYLKESHPVFFGFIGNRKG 519 + + +L + H G +G Sbjct: 190 LNTVDEAPRFLDKYHTFVLGLFEKFEG 216 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 122 VLELSDRFLEFSKDGMWFVKF--YAPWCSHCRRMEPTWAHVAQAL 250 VLEL+ + + DG FV YAPWC+ + P +A A AL Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATAL 123 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 37.1 bits (82), Expect = 0.014 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 10/66 (15%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTI-LFLKGS--------FQHE-YTGDRVKEDLINYA 411 V +AKVDCT+ + HI+ YP+I +F KGS HE Y GDR E L+ Sbjct: 199 VILAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDLKDDNAHHDHESYYGDRDTESLVKMV 258 Query: 412 MRMSQP 429 + + +P Sbjct: 259 VSLVEP 264 Score = 35.1 bits (77), Expect = 0.057 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQAL 250 V FYAPWC C ++P+W A+ + Sbjct: 163 VNFYAPWCYWCNLLKPSWEKAAKQI 187 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 LE K+ W V YAPWC C+ ME ++ +A+ L Sbjct: 358 LENRKEA-WLVVLYAPWCPFCQAMEASYIELAEKL 391 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 34.7 bits (76), Expect = 0.075 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 146 LEFSKDGMWFVKFYAPWCSHCRRMEPTWAHVAQAL 250 LE K+ W V YAPWC C+ ME ++ +A L Sbjct: 362 LENRKEA-WIVVLYAPWCPFCQAMEASFDELADKL 395 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 34.7 bits (76), Expect = 0.075 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 170 WFVKFYAPWCSHCRRMEPTWAHVAQAL 250 W V YAPWC C+ ME ++ +A L Sbjct: 376 WIVVLYAPWCPFCQAMEASYDELADKL 402 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 34.3 bits (75), Expect = 0.099 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQ 244 V FYAPWC R++P+W +Q Sbjct: 164 VNFYAPWCYWSNRLKPSWVKASQ 186 Score = 31.9 bits (69), Expect = 0.53 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 10/66 (15%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTI-LFLKGS--------FQHE-YTGDRVKEDLINYA 411 V + VDCT + HI+ YP+I +F +GS +HE Y GDR + L+ Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 412 MRMSQP 429 + +P Sbjct: 260 EELLKP 265 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 32.7 bits (71), Expect = 0.30 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 10/66 (15%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPTI-LFLKGS--------FQHE-YTGDRVKEDLINYA 411 V + VDCT A+ HI+ YP+I +F KGS +HE Y GDR + ++ Sbjct: 199 VLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMV 258 Query: 412 MRMSQP 429 + P Sbjct: 259 EGLVAP 264 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQAL 250 V F APWC R++P+W A + Sbjct: 163 VNFNAPWCYWSNRLKPSWEKAANII 187 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 32.3 bits (70), Expect = 0.40 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 173 FVKFYAPWCSHCRRMEPTWAHVAQ 244 FV F+APWC C+ ++P +AQ Sbjct: 96 FVDFWAPWCGPCKMIDPIVNELAQ 119 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 31.1 bits (67), Expect = 0.92 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 274 KVDCTRFTAVASHFHIRAYPTILFLKGSFQHEYTGDRVKEDLI 402 KVD VA F ++A PT +F+K E KE++I Sbjct: 63 KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEII 105 >At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis thaliana} Length = 651 Score = 31.1 bits (67), Expect = 0.92 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -2 Query: 402 NQILFNPISCVFMLKRSF*KQ--DSRISSDMKM*GHSCKTGTIDFGYFY 262 NQ+ NP++ VF KR ++ DS + SDMK+ + G D Y Sbjct: 60 NQVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIY 108 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 31.1 bits (67), Expect = 0.92 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +1 Query: 253 YTPVKVAKVDCTRFTAVASHFHIRAYPTILFLK-GSFQHEYTG---DRVKEDLINY 408 +T V K+D AVA F + A PT +F+K G+ G D + E L+ + Sbjct: 56 FTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111 >At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis thaliana} Length = 649 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -2 Query: 402 NQILFNPISCVFMLKRSF*KQ--DSRISSDMKM*GHSCKTG 286 NQ+ NPI+ VF KR ++ DS + SD+K+ + K+G Sbjct: 60 NQVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSG 100 >At1g61140.1 68414.m06888 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related similar to ATPase [Homo sapiens] GI:531196; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1287 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 219 NLLGRMWHKPCIYSRKSSQSRLYPFYSCGLTFSYPSLS 332 ++ G ++ K CIY R + S PF +C + + SLS Sbjct: 1006 SVCGHVFCKQCIYERLTGDSNHCPFANCNVRLTISSLS 1043 >At5g06750.1 68418.m00763 protein phosphatase 2C family protein / PP2C family protein similar to Ser/Thr protein phosphatase 2C (PP2C6) (GI:15020818) [Arabidopsis thaliana]; similar to protein phosphatase 2C (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 393 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +2 Query: 116 SRVLELSDRFLEFSKDGMW 172 +RVL+ SD+F+ F+ DG+W Sbjct: 276 TRVLQTSDKFVIFASDGLW 294 >At4g24550.2 68417.m03519 clathrin adaptor complexes medium subunit family protein contains Pfam profile: PF00928 adaptor complexes medium subunit family Length = 451 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 65 ITGLYIIFFTRIFNVSSSRVLELSDRFLEFSKD 163 + GLY + TR+ NVS S VLEL R KD Sbjct: 64 VVGLYFVATTRV-NVSPSLVLELLQRIARVIKD 95 >At4g24550.1 68417.m03518 clathrin adaptor complexes medium subunit family protein contains Pfam profile: PF00928 adaptor complexes medium subunit family Length = 380 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 65 ITGLYIIFFTRIFNVSSSRVLELSDRFLEFSKD 163 + GLY + TR+ NVS S VLEL R KD Sbjct: 64 VVGLYFVATTRV-NVSPSLVLELLQRIARVIKD 95 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQ 244 V F+APWC C+ ++P +AQ Sbjct: 103 VDFWAPWCGPCKMIDPLVNDLAQ 125 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 29.5 bits (63), Expect = 2.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEP 223 V+F+APWC CR + P Sbjct: 109 VEFWAPWCGPCRMIHP 124 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPT-ILFLKGSFQHEYTGDRVKEDLI 402 ++V K+D ++ ++A+ + I A PT ILF G + G + LI Sbjct: 114 IQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 134 SDRFLEFSKDG---MWFVKFYAPWCSHCRRMEPTWAHVAQ 244 +++FL KD + V FY WC CR M P A+ Sbjct: 101 AEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAK 140 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQ 244 V+F+A WC CR +P + VA+ Sbjct: 59 VEFFAHWCPACRNYKPHYEKVAR 81 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEPTWAHVAQAL 250 V FYA WC C+ M P V++ L Sbjct: 81 VDFYATWCGPCQLMVPILNEVSETL 105 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 262 VKVAKVDCTRFTAVASHFHIRAYPT-ILFLKGSFQHEYTG 378 + V K+D ++ ++A+ + I A PT ILF G + G Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEG 148 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 274 KVDCTRFTAVASHFHIRAYPTILFLK-GSFQHEYTGDRVKEDL 399 KVD +VA F + A PT +F+K G + G KEDL Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN-KEDL 106 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 176 VKFYAPWCSHCRRMEP 223 V+FYA WC CR + P Sbjct: 143 VEFYADWCEVCRELAP 158 >At4g36830.1 68417.m05223 GNS1/SUR4 membrane family protein weak similarity to long chain polyunsaturated fatty acid elongation enzyme [Isochrysis galbana] GI:17226123; contains Pfam profile PF01151: GNS1/SUR4 family Length = 289 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 454 NSIEYLKESHPVFFGFIGNRKGFYGKCLQFMLRNISL 564 NSI Y HP GF + +G F+ +ISL Sbjct: 7 NSITYFLSEHPYIVGFRWSNSQSWGSTWSFLFTSISL 43 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 274 KVDCTRFTAVASHFHIRAYPTILFLK 351 KVD +VAS + I+A PT +FLK Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLK 89 >At1g69730.1 68414.m08024 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 792 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +1 Query: 199 FTLSAHGTYLGA-CGTSLVYTPVKVAKVDCTRFTAVASHFHIRAYPTIL 342 F +S H + C + T VK + V CT + H HI+ Y +L Sbjct: 129 FYVSQHNELVAVGCNNTASLTNVKPSIVQCTSSCSTKPHTHIKDYLAVL 177 >At5g13680.1 68418.m01593 IKI3 family protein weak similarity to SP|O95163 IkappaB kinase complex-associated protein (IKK complex-associated protein) (p150) {Homo sapiens}; contains Pfam profile PF04762: IKI3 family Length = 1319 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 570 WFYAMTHEVIKHEIKVPNETAIFVYKD 650 WF++ H +K EI+ P E + V D Sbjct: 304 WFFSNNHWYLKQEIRYPREAGVTVMWD 330 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,438,088 Number of Sequences: 28952 Number of extensions: 362140 Number of successful extensions: 972 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 970 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1882599200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -