BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0606 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 25 0.65 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 25 0.65 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.5 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 25.0 bits (52), Expect = 0.65 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = +3 Query: 33 RKKKNATARDAVIGHRGSQTPTETGRQTSIAPRAGAYLYQTY 158 +++KN + S +P T S +P+A +LY + Sbjct: 142 KEEKNKVVTPKTSPNEASMSPQSTSSNNSASPKACQFLYNQF 183 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 25.0 bits (52), Expect = 0.65 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = +3 Query: 33 RKKKNATARDAVIGHRGSQTPTETGRQTSIAPRAGAYLYQTY 158 +++KN + S +P T S +P+A +LY + Sbjct: 162 KEEKNKVVTPKTSPNEASMSPQSTSSNNSASPKACQFLYNQF 203 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 139 LICIKHTIRISLDGTERFVQRESWRC 216 L+C HT+++S G R V +++ C Sbjct: 624 LVCENHTVKVSDFGLSRDVYQDNVYC 649 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,925 Number of Sequences: 336 Number of extensions: 3614 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -