BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0878 (737 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10900.1 68414.m01252 phosphatidylinositol-4-phosphate 5-kina... 28 5.6 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 27 9.8 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 27 9.8 >At1g10900.1 68414.m01252 phosphatidylinositol-4-phosphate 5-kinase family protein similar to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 754 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/43 (27%), Positives = 25/43 (58%) Frame = +1 Query: 181 PGGINALLEVGQSLAQQMQAANPDL*SNCDVSFDPQGLVKISH 309 PG +N +LE +++ Q ++ D+ + S P+GL+ ++H Sbjct: 583 PGQLNDILEPPNAMSDQESVSSVDVGLTQEHSIPPKGLLLVTH 625 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 311 FSVRMMCISIEPVRGDWDPQFSYWSVLLSSLSIPTSHDKSEILL 442 FSV I V G +D F Y S L+ SL TS+ ++ +L Sbjct: 64 FSVDYPNEYITAVGGSYDTVFGYGSALIKSLLFKTSYGRTSPIL 107 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 311 FSVRMMCISIEPVRGDWDPQFSYWSVLLSSLSIPTSHDKSEILL 442 FSV I V G +D F Y S L+ SL TS+ ++ +L Sbjct: 64 FSVDYPNEYITAVGGSYDTVFGYGSALIKSLLFKTSYGRTSPIL 107 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,376,683 Number of Sequences: 28952 Number of extensions: 289187 Number of successful extensions: 550 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -