BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0871 (767 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g32740.1 68414.m04037 expressed protein 29 4.5 At1g08760.1 68414.m00975 expressed protein similar to At1g21030,... 28 6.0 At3g02110.1 68416.m00177 serine carboxypeptidase S10 family prot... 28 7.9 >At1g32740.1 68414.m04037 expressed protein Length = 312 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = -3 Query: 189 RESDVPVGLLHTPPLVLEDALAPGLASHYYWAEGQAQDQPYHQLREKDVELQHA 28 R+S+ LH L LA HY G ++ +LREK+VE++ A Sbjct: 123 RQSEELDEFLHAQAEELRRTLAEKRKMHYKALLGAVEESLVRKLREKEVEIERA 176 >At1g08760.1 68414.m00975 expressed protein similar to At1g21030, At5g44890, At2g29240, At1g08740; similar to EST gb|N96641 Length = 748 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 116 SPGARASSRTRGGVCSKPT 172 SPG +SS+TRG + +KPT Sbjct: 567 SPGNNSSSKTRGNIQNKPT 585 >At3g02110.1 68416.m00177 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase II (CP-MII) GB:CAA70815 (SP:P08818) [Hordeum vulgare] Length = 473 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 7/42 (16%) Frame = -3 Query: 105 YYWAEGQAQDQPYHQL-------REKDVELQHAVSSYALELE 1 Y+W+ D+ YHQL R+K+ + + SYA+E E Sbjct: 233 YWWSHAMISDRTYHQLISTCDFSRQKESDECETLYSYAMEQE 274 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,580,870 Number of Sequences: 28952 Number of extensions: 309250 Number of successful extensions: 652 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -