BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0869 (699 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023338-1|AAY55754.1| 264|Drosophila melanogaster IP10175p pro... 30 2.6 AE014297-1808|AAF55028.1| 264|Drosophila melanogaster CG9722-PA... 30 2.6 >BT023338-1|AAY55754.1| 264|Drosophila melanogaster IP10175p protein. Length = 264 Score = 30.3 bits (65), Expect = 2.6 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 8/81 (9%) Frame = +1 Query: 49 IVRLYLLFLVIILKVLAKYMQYCLSKISKLLFMAPREIFVIIVL--------LF*NSNMQ 204 I ++YL+ L ++ L + K +L+ IFV+ +L L N +++ Sbjct: 55 IRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCNEDLR 114 Query: 205 RNVVTSYIFISLYALAENIVL 267 R ++IF+S + +AE+ +L Sbjct: 115 RQTPANFIFLSAFTIAESFLL 135 >AE014297-1808|AAF55028.1| 264|Drosophila melanogaster CG9722-PA protein. Length = 264 Score = 30.3 bits (65), Expect = 2.6 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 8/81 (9%) Frame = +1 Query: 49 IVRLYLLFLVIILKVLAKYMQYCLSKISKLLFMAPREIFVIIVL--------LF*NSNMQ 204 I ++YL+ L ++ L + K +L+ IFV+ +L L N +++ Sbjct: 55 IRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCNEDLR 114 Query: 205 RNVVTSYIFISLYALAENIVL 267 R ++IF+S + +AE+ +L Sbjct: 115 RQTPANFIFLSAFTIAESFLL 135 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,812,663 Number of Sequences: 53049 Number of extensions: 525313 Number of successful extensions: 859 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -