BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0869 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55840.1 68418.m06958 pentatricopeptide (PPR) repeat-containi... 28 5.2 At3g56620.1 68416.m06296 integral membrane family protein / nodu... 27 9.0 >At5g55840.1 68418.m06958 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 1274 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 319 TIHTLKLRTITQGMLYFSRLYFPPRHIMK 233 T H ++L IT +L +R+Y P RHI+K Sbjct: 68 TDHIVQLVCITTHILVRARMYDPARHILK 96 >At3g56620.1 68416.m06296 integral membrane family protein / nodulin MtN21-related similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 377 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/68 (23%), Positives = 28/68 (41%) Frame = +3 Query: 15 ITCGNPVCNLYYSEIVFIIFGNNFKSIGKVYAVLFIQNFKIIIYGPKGDFCNHCIIILKL 194 +T NP+ + S I F+I G + + + +++G +GD I K Sbjct: 276 VTAFNPLVVIIGSIIGFLILNQTLNLGGVLGMAILVVGVCTVLWGKEGDIDEEENIEEKF 335 Query: 195 EHAKECCN 218 +CCN Sbjct: 336 VEIVKCCN 343 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,558,956 Number of Sequences: 28952 Number of extensions: 254399 Number of successful extensions: 413 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 413 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -