BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0860 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 142 1e-34 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 59 2e-09 SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) 32 0.35 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 28 4.3 SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) 27 7.6 SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 27 7.6 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 142 bits (345), Expect = 1e-34 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = +3 Query: 27 KPRGIRTARKHVNHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQP 206 KPRG+RTARK +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQP Sbjct: 2 KPRGLRTARKLRSHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQP 61 Query: 207 NSAIRKCVRVQLIKNGRK 260 NSAIRKCVRVQLIKNG+K Sbjct: 62 NSAIRKCVRVQLIKNGKK 79 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 254 KKVTAFVPRDGCLNHIEENDE 316 KK+TAFVP DGCLN+IEENDE Sbjct: 78 KKITAFVPNDGCLNYIEENDE 98 Score = 37.5 bits (83), Expect = 0.007 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = +1 Query: 322 VAGFGRKGHAVGDIPGV 372 ++GFGR+GHAVGDIPG+ Sbjct: 101 ISGFGRRGHAVGDIPGI 117 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 59.3 bits (137), Expect = 2e-09 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 322 VAGFGRKGHAVGDIPGVRFKXXXXXXXXXXXXYKEKKERPRS 447 ++GFGR+GHAVGDIPGVRFK +KEKKERPRS Sbjct: 102 ISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 Score = 54.0 bits (124), Expect = 8e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 177 EKVGVEAKQPNSAIRKCVRVQLIKNGRK 260 ++ GVEAKQPNSAIRKCVRVQLIKNG+K Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKK 80 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 254 KKVTAFVPRDGCLNHIEENDE 316 KK+TAFVP DGCLN+IEENDE Sbjct: 79 KKITAFVPNDGCLNYIEENDE 99 >SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) Length = 488 Score = 31.9 bits (69), Expect = 0.35 Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 5/79 (6%) Frame = -2 Query: 244 MSCTRTHLRMAELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHR 80 M C + E+ C PT R T DA P GL H M L+ + R Sbjct: 58 MPCQLDYPNYREMPCQLDCPTTERCPANWTTQLQRDALPTGLPKHR-EMPCQLDYPTTER 116 Query: 79 CSRRWFTCLRAVRIPRGLP 23 C W T L+ +P GLP Sbjct: 117 CPANWTTQLQRDALPTGLP 135 Score = 29.1 bits (62), Expect = 2.5 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = -2 Query: 211 ELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHRCSRRWFTCLRA 47 E+ C PT R T DA P GL ++ M L+ + RC W T L+ Sbjct: 139 EMPCQLDYPTTERCPANWTTQLQRDALPTGLP-NYREMSCQLDYPTTERCPANWTTQLQR 197 Query: 46 VRIPRGLP 23 +P GLP Sbjct: 198 DTLPTGLP 205 Score = 28.7 bits (61), Expect = 3.3 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = -2 Query: 211 ELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHRCSRRWFTCLRA 47 E+ C PT R T DA P GL ++ M L+ + RC W T L+ Sbjct: 104 EMPCQLDYPTTERCPANWTTQLQRDALPTGLP-NYREMPCQLDYPTTERCPANWTTQLQR 162 Query: 46 VRIPRGLP 23 +P GLP Sbjct: 163 DALPTGLP 170 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 107 SPHGYEMEG*PFRWCISRKGHRPRESWCRS*AA 205 S HG MEG P W +S G P+ S C S +A Sbjct: 85 SQHGTRMEGVPVCWYVSVWGLSPQVSQCDSVSA 117 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -1 Query: 287 NRHGGRMRSLS--SVLNELYTDAFADGRVGLLSFYTNFLEDDALCVRCTTE-RVSLPFRT 117 +R+GGRM+SL+ S N + D + + + + ED++ + +T + LP+RT Sbjct: 1851 SRNGGRMKSLANRSGRNGVIRDLLGSQALDTAASFESLTEDESAAITGSTVCSIPLPYRT 1910 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -2 Query: 175 RTMPFA*D-APPKGLAFHFVPMW-AFLN-SLSAHR 80 R +PF+ APPKG F VP+W +F N S+ HR Sbjct: 902 RKVPFSSVLAPPKGYRFLIVPLWRSFSNRSVFGHR 936 >SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) Length = 255 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 67 TVVNSDGRTKNSRKPTWVRNGRLTLSVVHLT 159 T V R N++KP +R+GR+T+S+ +T Sbjct: 103 THVQFHHRDTNTKKPVHLRDGRVTVSLAAMT 133 >SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 256 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 99 ILCPPIAVHDGGSRAYAPFV 40 ++ PP + DG SRA+APF+ Sbjct: 215 LIKPPSTIVDGRSRAHAPFI 234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,795,439 Number of Sequences: 59808 Number of extensions: 372545 Number of successful extensions: 779 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -