BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0858 (749 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 4.6 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 4.6 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 4.6 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 458 ACTQDPTQPEDRNCLHSLAGRH 523 AC P QPE +SL G H Sbjct: 172 ACMGPPPQPEPPVTFNSLNGAH 193 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 264 CGTFGFGETHHSVAQIIVPGFFRRFFLSHRTCRCGSR 154 CG F G+ ++ A GFF+R +R C ++ Sbjct: 41 CGDFSSGKHYNIFACDGCAGFFKRSIRRNRQYVCKAK 77 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 264 CGTFGFGETHHSVAQIIVPGFFRRFFLSHRTCRCGSR 154 CG F G+ ++ A GFF+R +R C ++ Sbjct: 41 CGDFSSGKHYNIFACDGCAGFFKRSIRRNRQYVCKAK 77 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,794 Number of Sequences: 336 Number of extensions: 4036 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -