BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0858 (749 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila... 77 9e-15 At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila... 77 9e-15 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 76 2e-14 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 30 1.9 At1g20540.1 68414.m02559 transducin family protein / WD-40 repea... 29 4.4 >At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 77.4 bits (182), Expect = 9e-15 Identities = 39/65 (60%), Positives = 45/65 (69%) Frame = +2 Query: 509 LAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHF 688 LAGR GKRVV + L SGLLLVTGPF N PLRR+ Q YVIGTST++ + L K F Sbjct: 98 LAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDK-F 156 Query: 689 NDDYF 703 +D YF Sbjct: 157 DDKYF 161 >At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 77.4 bits (182), Expect = 9e-15 Identities = 39/65 (60%), Positives = 45/65 (69%) Frame = +2 Query: 509 LAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHF 688 LAGR GKRVV + L SGLLLVTGPF N PLRR+ Q YVIGTST++ + L K F Sbjct: 98 LAGRFKGKRVVFLKQLASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDK-F 156 Query: 689 NDDYF 703 +D YF Sbjct: 157 DDKYF 161 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 76.2 bits (179), Expect = 2e-14 Identities = 39/65 (60%), Positives = 44/65 (67%) Frame = +2 Query: 509 LAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHF 688 LAGR GKRVV + L SGLLLVTGPF N PLRR+ Q YVIGTST+I + K F Sbjct: 98 LAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVNTEK-F 156 Query: 689 NDDYF 703 +D YF Sbjct: 157 DDKYF 161 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 381 PLKRRKSFYPTQEKIRASSGGRPFS-KHVRR 470 P++RR+S P +E++ S GGR S H+++ Sbjct: 525 PVRRRRSLTPDEERVSLSQGGRHTSPSHIKQ 555 >At1g20540.1 68414.m02559 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Rbap46 polypeptide (GI:9454362) [Gallus gallus] Length = 351 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 347 WR*EEWGNQNSTPQT*EV--LLPHSGENPCLIWWPS 448 W+ E Q ++PQ V L H G+ C++WWPS Sbjct: 96 WQIPELYGQLNSPQLERVASLDAHVGKINCVLWWPS 131 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,820,091 Number of Sequences: 28952 Number of extensions: 332314 Number of successful extensions: 732 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -