BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0841 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 29 2.9 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 29 2.9 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 29 2.9 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 29 2.9 At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family... 28 5.0 At1g48310.1 68414.m05396 SNF2 domain-containing protein / helica... 28 5.0 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 45 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 224 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 327 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 380 Query: 225 NAQKKRLT 248 +A + +T Sbjct: 381 SAIGEGMT 388 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 45 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 224 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 327 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 380 Query: 225 NAQKKRLT 248 +A + +T Sbjct: 381 SAIGEGMT 388 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 45 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 224 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 326 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 379 Query: 225 NAQKKRLT 248 +A + +T Sbjct: 380 SAIGEGMT 387 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 45 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 224 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 325 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 378 Query: 225 NAQKKRLT 248 +A + +T Sbjct: 379 SAIGEGMT 386 >At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 310 Score = 28.3 bits (60), Expect = 5.0 Identities = 24/93 (25%), Positives = 39/93 (41%) Frame = +3 Query: 9 ISSSSEKLAIAGKLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKR 188 I S EK G+ PLK + + EI+ + +G RT HK ++++ R R +R Sbjct: 74 IESYKEKWFAIGRGPLKSTHWEEIAVAASSRSGVERTSTQCRHK----IEKMRKRFRSER 129 Query: 189 PYRVPSLTHYLKNAQKKRLTSGHLTNACTPLFR 287 P N ++ +S + PL R Sbjct: 130 QSMGPISIWPFYNQMEELDSSNPAPISARPLTR 162 >At1g48310.1 68414.m05396 SNF2 domain-containing protein / helicase domain-containing protein contains similarity to DNA-dependent ATPase A GI:6651385 from [Bos taurus]}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 Length = 673 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 210 THYLKNAQKKRLTSGHLTNACTPLFRQKHRALML*G 317 +H+LKN Q KR T+AC P+ ++ A++L G Sbjct: 304 SHFLKNGQAKR------TSACLPVIKKAQYAILLSG 333 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,413,144 Number of Sequences: 28952 Number of extensions: 254487 Number of successful extensions: 479 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -