BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0839 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 2.6 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 4.6 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 4.6 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 4.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 4.6 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 4.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 4.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 4.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 4.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 6.0 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 665 YTKNNSYLAGASNCSEWMFGNQN 597 +T NS L G N S+W N+N Sbjct: 211 FTAENSPLYGGVNESDWQQQNRN 233 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 49 STRKISKPSTS-ASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGCHGW 207 ST KP+TS AS+ SPA +S+ + G +++++ + + + W Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPW 203 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 49 STRKISKPSTS-ASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGCHGW 207 ST KP+TS AS+ SPA +S+ + G +++++ + + + W Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPW 203 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 560 QRCAYTFNSWKVYFDYQTS 616 ++ +TF SWKV + TS Sbjct: 51 EKLHFTFKSWKVLYTSLTS 69 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 49 STRKISKPSTS-ASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGCHGW 207 ST KP+TS AS+ SPA +S+ + G +++++ + + + W Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPW 203 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 49 STRKISKPSTS-ASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGCHGW 207 ST KP+TS AS+ SPA +S+ + G +++++ + + + W Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPW 203 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 49 STRKISKPSTS-ASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGCHGW 207 ST KP+TS AS+ SPA +S+ + G +++++ + + + W Sbjct: 106 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPW 159 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 49 STRKISKPSTS-ASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGCHGW 207 ST KP+TS AS+ SPA +S+ + G +++++ + + + W Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPW 203 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 49 STRKISKPSTS-ASKESCSPAK*CTSSCGSIDPGYDSSSTSAALAIRADGCHGW 207 ST KP+TS AS+ SPA +S+ + G +++++ + + + W Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNPPQIYPW 203 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 49 STRKISKPSTSASKESCSPAK*CTSSCGSIDPGYDSSSTS 168 ST KP+TS + ++ S TSS S + +++ S Sbjct: 150 STSPPGKPATSTTSQNLSSPASSTSSTSSTEKAGTNNNNS 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,963 Number of Sequences: 336 Number of extensions: 3226 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -