BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0838 (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 29 4.3 At2g35840.2 68415.m04401 sucrose-phosphatase 1 (SPP1) identical ... 28 7.6 At2g35840.1 68415.m04400 sucrose-phosphatase 1 (SPP1) identical ... 28 7.6 At1g51420.1 68414.m05788 sucrose-phosphatase, putative similar t... 27 10.0 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 645 SGSVSGSLQATDRLMKELRDIYRSHS 722 SGS SG + ++ K L D Y+SHS Sbjct: 68 SGSASGKPSVSSQMAKRLDDAYKSHS 93 >At2g35840.2 68415.m04401 sucrose-phosphatase 1 (SPP1) identical to sucrose-phosphatase (SPP1) [Arabidopsis thaliana] GI:11127757 Length = 422 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 149 SVDELTCRFVGKNGKKYEIHANITETYPTTPPVWFEKV 262 ++DEL K GKK+ + A+ TTP W K+ Sbjct: 335 TIDELRKYHGDKQGKKFRVWADQVLATDTTPGTWIVKL 372 >At2g35840.1 68415.m04400 sucrose-phosphatase 1 (SPP1) identical to sucrose-phosphatase (SPP1) [Arabidopsis thaliana] GI:11127757 Length = 422 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 149 SVDELTCRFVGKNGKKYEIHANITETYPTTPPVWFEKV 262 ++DEL K GKK+ + A+ TTP W K+ Sbjct: 335 TIDELRKYHGDKQGKKFRVWADQVLATDTTPGTWIVKL 372 >At1g51420.1 68414.m05788 sucrose-phosphatase, putative similar to sucrose-phosphatase (SPP1) [Arabidopsis thaliana] GI:11127757; contains Pfam profile PF05116: Sucrose-6F-phosphate phosphohydrolase Length = 423 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 149 SVDELTCRFVGKNGKKYEIHANITETYPTTPPVWFEKV 262 ++DEL + K GKK+ + + TTP W K+ Sbjct: 336 TIDELGKYYGDKKGKKFRVWTDQVLATDTTPGTWIVKL 373 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,757,205 Number of Sequences: 28952 Number of extensions: 309867 Number of successful extensions: 827 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -