BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0831 (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30| Best HMM Match : DNA_pol_delta_4 (HMM E-Value=2.2) 28 6.1 SB_33651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 >SB_30| Best HMM Match : DNA_pol_delta_4 (HMM E-Value=2.2) Length = 269 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/82 (23%), Positives = 34/82 (41%) Frame = -3 Query: 592 RTSLLSRAKPSTDDSSNFVLPVAASVSIPMPTLDPGGRSRSYHPRLQLHA*SGSNRIYQN 413 RTS SR++ + D + L ++ GR +S PRL+ +G N Sbjct: 18 RTSACSRSRSCSADRTEPRLTAQERHHHRSSSVPAHGRPQSTEPRLKQSTATGQNTTITE 77 Query: 412 SQQMDGIHLNPSNQDPQEFHCT 347 ++ G H+ S + + C+ Sbjct: 78 ESEVHGKHVTSSPRSGKPVGCS 99 >SB_33651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -3 Query: 439 SGSNRIYQNSQQMDGIHLNPSNQDPQEF 356 +G +RI++NSQ++ IH N +Q+ QEF Sbjct: 46 AGISRIHKNSQELTRIHKN--SQESQEF 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,569,044 Number of Sequences: 59808 Number of extensions: 427141 Number of successful extensions: 1066 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1065 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -