BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0819 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_36943| Best HMM Match : MACPF (HMM E-Value=0.67) 28 6.7 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = -2 Query: 460 VPLNTRWAVSSSTHLSNNIYIAN 392 +P++T+ +VSSST +NIY+AN Sbjct: 389 LPISTKLSVSSSTSSLDNIYMAN 411 >SB_36943| Best HMM Match : MACPF (HMM E-Value=0.67) Length = 486 Score = 28.3 bits (60), Expect = 6.7 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +1 Query: 370 CIHRTFASSQYIYYCLGGWTSSQPTWC*VVLEP--IDIHNVNAPATLRLSSKVSV*LQRL 543 C+H T AS+ +Y S Q TW V + P + I+ V + L S+ RL Sbjct: 416 CLHFTAASAGTVYVVFSAIPSDQSTWYYVEISPFAVGIYKVRLFRSRNLRCHASIECARL 475 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,611,883 Number of Sequences: 59808 Number of extensions: 479723 Number of successful extensions: 926 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -