BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0805 (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47250.3 68416.m05132 expressed protein contains Pfam profile... 28 7.6 At3g47250.2 68416.m05131 expressed protein contains Pfam profile... 28 7.6 At3g47250.1 68416.m05130 expressed protein contains Pfam profile... 28 7.6 >At3g47250.3 68416.m05132 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 480 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -3 Query: 683 LELKRNSLLIPVFKLYGSRRFGIFFLNDIFKKVTVIKQTYFNC*TDISNY 534 ++LK+N L IP+ +L G F++ IF +Q Y DI++Y Sbjct: 322 IKLKKNKLQIPLLRLDG-------FISSIFLNCVAFEQFYTESTNDITSY 364 >At3g47250.2 68416.m05131 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 480 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -3 Query: 683 LELKRNSLLIPVFKLYGSRRFGIFFLNDIFKKVTVIKQTYFNC*TDISNY 534 ++LK+N L IP+ +L G F++ IF +Q Y DI++Y Sbjct: 322 IKLKKNKLQIPLLRLDG-------FISSIFLNCVAFEQFYTESTNDITSY 364 >At3g47250.1 68416.m05130 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 480 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -3 Query: 683 LELKRNSLLIPVFKLYGSRRFGIFFLNDIFKKVTVIKQTYFNC*TDISNY 534 ++LK+N L IP+ +L G F++ IF +Q Y DI++Y Sbjct: 322 IKLKKNKLQIPLLRLDG-------FISSIFLNCVAFEQFYTESTNDITSY 364 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,694,112 Number of Sequences: 28952 Number of extensions: 249367 Number of successful extensions: 403 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -