BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0800 (692 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 69 3e-12 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 69 3e-12 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 62 3e-10 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 59 3e-09 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 58 4e-09 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 58 4e-09 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 58 4e-09 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 58 7e-09 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 57 1e-08 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 54 1e-07 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 53 2e-07 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 53 2e-07 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 52 5e-07 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 40 3e-06 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 36 8e-06 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 46 3e-05 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 45 6e-05 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 45 6e-05 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 44 7e-05 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 44 1e-04 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 42 4e-04 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 42 4e-04 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 42 4e-04 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 42 5e-04 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 41 7e-04 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 41 9e-04 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 41 9e-04 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 40 0.001 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 40 0.001 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 40 0.001 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 40 0.002 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 40 0.002 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 40 0.002 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 35 0.003 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 39 0.004 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 39 0.004 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 39 0.004 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 39 0.004 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 39 0.004 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 39 0.004 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 39 0.004 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 38 0.005 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 38 0.005 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.005 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 38 0.006 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 38 0.008 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 38 0.008 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 37 0.011 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 37 0.011 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 37 0.011 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 37 0.011 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 37 0.015 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 36 0.019 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 36 0.019 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 36 0.019 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 36 0.019 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.019 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 36 0.025 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 36 0.025 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 36 0.025 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 36 0.025 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 36 0.025 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 36 0.034 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 36 0.034 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 35 0.045 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 35 0.045 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 35 0.059 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 35 0.059 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 35 0.059 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 34 0.078 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 34 0.078 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 34 0.078 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.078 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 34 0.078 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 34 0.078 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 34 0.078 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 34 0.078 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 34 0.078 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 34 0.10 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 34 0.10 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 34 0.10 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 34 0.10 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 34 0.10 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 34 0.10 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 34 0.10 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 33 0.14 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 33 0.14 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 33 0.14 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 33 0.14 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 33 0.14 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 33 0.14 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 33 0.24 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 33 0.24 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 33 0.24 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 33 0.24 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 32 0.31 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 32 0.31 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 32 0.31 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 32 0.31 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 32 0.41 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 32 0.41 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 31 0.55 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 31 0.55 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 31 0.55 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 31 0.55 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 31 0.55 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 31 0.55 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 31 0.73 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 31 0.73 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 31 0.73 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 31 0.73 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 31 0.73 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 31 0.73 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 31 0.73 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 31 0.73 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 31 0.73 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 31 0.73 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 31 0.73 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 31 0.73 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 31 0.96 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 31 0.96 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 31 0.96 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 31 0.96 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 30 1.3 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 30 1.3 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 30 1.3 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 30 1.3 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 30 1.7 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 30 1.7 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 30 1.7 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 30 1.7 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 30 1.7 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 29 2.2 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 2.2 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 2.2 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 29 2.2 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 29 2.9 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 29 2.9 At2g47390.1 68415.m05915 expressed protein 29 2.9 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 29 2.9 At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger) fa... 29 3.9 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 29 3.9 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 29 3.9 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 29 3.9 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 29 3.9 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 29 3.9 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 29 3.9 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 29 3.9 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 5.1 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 28 5.1 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 28 5.1 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 28 5.1 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 28 5.1 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 28 5.1 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.1 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.1 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.1 At5g22830.1 68418.m02669 magnesium transporter CorA-like family ... 28 6.8 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 28 6.8 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 28 6.8 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 28 6.8 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 28 6.8 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 27 8.9 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 27 8.9 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 27 8.9 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 27 8.9 At2g33440.1 68415.m04099 splicing factor family protein similar ... 27 8.9 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 27 8.9 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 68.9 bits (161), Expect = 3e-12 Identities = 38/98 (38%), Positives = 57/98 (58%), Gaps = 11/98 (11%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KA 422 F YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKG 97 Query: 423 RHG---------KIFVGGLSSEISDDEIRNFFSEFGTI 509 G KIFVGG+ S +++DE+++FF+++G + Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNV 135 Score = 44.4 bits (100), Expect = 7e-05 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 6/91 (6%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTINNKKVDPK 410 F YG + V D T RSRGF F++F + E +D++++ G + + KK +PK Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Query: 411 KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 503 K+ R + S+D ++ +G Sbjct: 189 KSLNRSPPSYGSHPRGRSSNDSYASYGGPYG 219 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 682 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/55 (36%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +2 Query: 503 NYLEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 664 N +E ++ D N+ +GF F+ F+SE+VV++LL K + +V++K+A PK Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 136 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFG 255 G S++ N G K+F+GGL +TT+ HFG Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFG 40 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 420 ARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 A GKIF+GGL + ++ F ++G I Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEI 45 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 68.9 bits (161), Expect = 3e-12 Identities = 38/98 (38%), Positives = 57/98 (58%), Gaps = 11/98 (11%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KA 422 F YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKG 97 Query: 423 RHG---------KIFVGGLSSEISDDEIRNFFSEFGTI 509 G KIFVGG+ S +++DE+++FF+++G + Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNV 135 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 682 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 374 F YG + V D T RSRGF F++F + E +D++++ G Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +2 Query: 503 NYLEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 604 N +E ++ D N+ +GF F+ F+SE+VV++LL Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 136 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFG 255 G S++ N G K+F+GGL +TT+ HFG Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFG 40 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 420 ARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 A GKIF+GGL + ++ F ++G I Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEI 45 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 62.1 bits (144), Expect = 3e-10 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 9/96 (9%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F YGEI + D TG+ RGF F+ + +DKV+ H I K+V+ K+ R Sbjct: 62 FGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPRG 120 Query: 429 G---------KIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVGG+ S + DDE + FF +FG + Sbjct: 121 SMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGEL 156 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/60 (31%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVDPKKAKAR 425 F +GE++ + D +TGRSRGF F+ +++ + +D ++A G ++ +V+ KKA+ + Sbjct: 150 FMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPK 664 D + + +GF F+T+ESE +V+ LL R + G +V++K+A PK Sbjct: 164 DHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 35.9 bits (79), Expect = 0.025 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 88 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFG 255 +D D + + + E+ SQ H+ G D K+FVGGL+ ETT E HFG Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGG---GVDSAGKIFVGGLARETTSAEFLKHFG 63 Score = 34.3 bits (75), Expect = 0.078 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 D+ Q +GF F+T+ VV+ +++ I GK+V++KR P+ Sbjct: 76 DRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GKIFVGGL+ E + E F ++G I Sbjct: 42 GKIFVGGLARETTSAEFLKHFGKYGEI 68 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 58.8 bits (136), Expect = 3e-09 Identities = 35/99 (35%), Positives = 53/99 (53%), Gaps = 12/99 (12%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK------ 410 F +GE+ + TD TG RGF F+ F +KV+ +H I+++KVD K Sbjct: 86 FGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPRG 144 Query: 411 ------KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 KA ++ KIFVGGL + +DE++N+F +G I Sbjct: 145 DKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYFCVYGDI 183 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/60 (36%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 425 F YG+I + D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+V+ K+A+ + Sbjct: 177 FCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDG 673 +E ++ +D + +GF F+TF++E V+ L K +G K+V++KRA PK G Sbjct: 184 IEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPKRTG 239 Score = 37.9 bits (84), Expect = 0.006 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Frame = +1 Query: 97 TTDNQLNGNA--ENGG---GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFG 255 T D++ NG A + GG S DH + + KLFVGG+SWETT + ++FG Sbjct: 31 TFDDRRNGGAAVDTGGIQMKHSVDHRHSSS-SMSSPGKLFVGGVSWETTAETFANYFG 87 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+FVGG+S E + + N+F +FG + Sbjct: 66 GKLFVGGVSWETTAETFANYFGKFGEV 92 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 670 D+ +GF F+TF V +L+ I ++VD+KR P+ D Sbjct: 100 DRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLPRGD 145 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 58.4 bits (135), Expect = 4e-09 Identities = 41/112 (36%), Positives = 58/112 (51%), Gaps = 25/112 (22%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 425 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 426 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFGTI 509 HG KIFVGGL S I+++E +N+F +FGTI Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTI 136 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 676 +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 138 DVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 36.3 bits (80), Expect = 0.019 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHFGH 258 KLF+GG+SW+T ++ LRD+F + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.9 bits (74), Expect = 0.10 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+F+GG+S + ++ +R++FS +G + Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDV 32 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 58.4 bits (135), Expect = 4e-09 Identities = 41/112 (36%), Positives = 58/112 (51%), Gaps = 25/112 (22%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 425 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 426 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFGTI 509 HG KIFVGGL S I+++E +N+F +FGTI Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTI 136 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 676 +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 138 DVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 36.3 bits (80), Expect = 0.019 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHFGH 258 KLF+GG+SW+T ++ LRD+F + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.9 bits (74), Expect = 0.10 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+F+GG+S + ++ +R++FS +G + Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDV 32 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 58.4 bits (135), Expect = 4e-09 Identities = 41/112 (36%), Positives = 58/112 (51%), Gaps = 25/112 (22%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 425 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 426 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFGTI 509 HG KIFVGGL S I+++E +N+F +FGTI Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTI 136 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 676 +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 138 DVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 36.3 bits (80), Expect = 0.019 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHFGH 258 KLF+GG+SW+T ++ LRD+F + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.9 bits (74), Expect = 0.10 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+F+GG+S + ++ +R++FS +G + Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDV 32 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 57.6 bits (133), Expect = 7e-09 Identities = 41/115 (35%), Positives = 57/115 (49%), Gaps = 28/115 (24%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR- 425 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 35 FGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRD 93 Query: 426 ------------------HG---------KIFVGGLSSEISDDEIRNFFSEFGTI 509 HG KIFVGGL S I++ E +N+F +FGTI Sbjct: 94 DQQVLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTI 148 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +G I + V D NT R RGF FI F + ES+D V+ H +N K V+ K+A Sbjct: 142 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRA 197 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 +V + +D + +GF FITF+SE+ V+ +L + GK V+VKRA PK Sbjct: 150 DVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPK 200 Score = 35.1 bits (77), Expect = 0.045 Identities = 11/21 (52%), Positives = 19/21 (90%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHFG 255 KLF+GG+SW+T ++ L+++FG Sbjct: 16 KLFIGGISWDTDEERLQEYFG 36 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 670 D+T + +GF FI F V ++ K I G+ V+ K+A P+ D Sbjct: 49 DRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRDD 94 Score = 30.7 bits (66), Expect = 0.96 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKERA 557 GK+F+GG+S + ++ ++ +F ++G + + + RT RA Sbjct: 15 GKLFIGGISWDTDEERLQEYFGKYGDL--VEAVIMRDRTTGRA 55 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 56.8 bits (131), Expect = 1e-08 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 25/112 (22%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F YGE+ V D TGR RGF F++F P +D+V+ +H+I+ ++VD K+A +R Sbjct: 26 FTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSRE 84 Query: 429 -------------------------GKIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVGGL ++D+E R +F +G + Sbjct: 85 EQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYGPV 136 Score = 55.2 bits (127), Expect = 4e-08 Identities = 24/59 (40%), Positives = 38/59 (64%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 688 +V + +D+ N+ +GF F++F+SE V+ +L + GK+V+VKRA PK PGG G Sbjct: 138 DVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKDANPGGGG 196 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/69 (30%), Positives = 36/69 (52%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F YG + + + D T R RGF F+ F + +++D V+ H ++ K+V+ K+A + Sbjct: 130 FEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKD 189 Query: 429 GKIFVGGLS 455 GG S Sbjct: 190 ANPGGGGRS 198 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +1 Query: 184 DDRKLFVGGLSWETTDKELRDHF 252 D KLFVGG+SWET + +LR+HF Sbjct: 4 DQGKLFVGGISWETDEDKLREHF 26 Score = 35.5 bits (78), Expect = 0.034 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +2 Query: 482 KLLQ*IWNYLEVEMPF---DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKR 652 KL + NY EV DK + +GF F+ F V++ +L+ K +I +EVDVKR Sbjct: 21 KLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKR 79 Query: 653 ATPKPD 670 A + + Sbjct: 80 AMSREE 85 Score = 34.3 bits (75), Expect = 0.078 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+FVGG+S E +D++R F+ +G + Sbjct: 6 GKLFVGGISWETDEDKLREHFTNYGEV 32 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +1 Query: 88 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRD---DDRKLFVGGLSWETTDKELRDHF 252 +++ ++ + G + + N++ + G D +K+FVGGL TD+E R +F Sbjct: 73 REVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYF 130 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 56.0 bits (129), Expect = 2e-08 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 21/108 (19%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 429 G---------------------KIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVGGL+S +++ E + +F++FG I Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMI 132 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 126 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 134 DVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 37.1 bits (82), Expect = 0.011 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 KLF+GG+SWET++ LRD+F Sbjct: 7 KLFIGGISWETSEDRLRDYF 26 Score = 35.1 bits (77), Expect = 0.045 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+F+GG+S E S+D +R++F FG + Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEV 32 Score = 30.7 bits (66), Expect = 0.96 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 169 APGRDDDRKLFVGGLSWETTDKELRDHF 252 +PG + +K+FVGGL+ T+ E + +F Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYF 126 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 56.0 bits (129), Expect = 2e-08 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 21/108 (19%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 429 G---------------------KIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVGGL+S +++ E + +F++FG I Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMI 132 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 126 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 134 DVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 37.1 bits (82), Expect = 0.011 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 KLF+GG+SWET++ LRD+F Sbjct: 7 KLFIGGISWETSEDRLRDYF 26 Score = 35.1 bits (77), Expect = 0.045 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+F+GG+S E S+D +R++F FG + Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEV 32 Score = 30.7 bits (66), Expect = 0.96 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 169 APGRDDDRKLFVGGLSWETTDKELRDHF 252 +PG + +K+FVGGL+ T+ E + +F Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYF 126 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 53.6 bits (123), Expect = 1e-07 Identities = 36/112 (32%), Positives = 53/112 (47%), Gaps = 25/112 (22%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F +GE+ + V + TGR RGF F+ F P ID+V+ +H I+N+ VD K+A +R Sbjct: 26 FSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL-QDKHHIDNRDVDVKRAMSRE 84 Query: 429 -------------------------GKIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVGGL ++ DE R +F +G + Sbjct: 85 EQSPAGRSGTFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFETYGPV 136 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 679 D+T + +GF F++F+SE V+ +L + GK+V+VKRA PK PG Sbjct: 144 DQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKDANPG 193 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F YG + + D T R RGF F+ F + +S+D V+ H +N K+V+ K+A Sbjct: 130 FETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRA 185 Score = 34.7 bits (76), Expect = 0.059 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 184 DDRKLFVGGLSWETTDKELRDHFGH 258 D KLF+GG+SW+T + LR++F + Sbjct: 4 DQGKLFIGGISWDTDENLLREYFSN 28 Score = 34.3 bits (75), Expect = 0.078 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GPGG 682 L+V + +K + +GF F+ F V++ +L+ K I ++VDVKRA + + P G Sbjct: 33 LQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD-KHHIDNRDVDVKRAMSREEQSPAG 90 Score = 33.1 bits (72), Expect = 0.18 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+F+GG+S + ++ +R +FS FG + Sbjct: 6 GKLFIGGISWDTDENLLREYFSNFGEV 32 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 53.2 bits (122), Expect = 2e-07 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 23/109 (21%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---- 416 F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 417 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFGT 506 R KIFVGGL S +++ + + +F +FGT Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 679 +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 136 DVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPG 191 Score = 35.9 bits (79), Expect = 0.025 Identities = 11/25 (44%), Positives = 21/25 (84%) Frame = +1 Query: 178 RDDDRKLFVGGLSWETTDKELRDHF 252 + D+ KLF+GG+SW+T ++ L+++F Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYF 26 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/44 (34%), Positives = 28/44 (63%) Frame = +3 Query: 426 HGKIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKERA 557 +GK+F+GG+S + +++ ++ +FS FG + + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEV--IEAVILKDRTTGRA 46 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 121 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 N N S S PGR RK+FVGGL T+ + + +F Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYF 128 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 53.2 bits (122), Expect = 2e-07 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 23/109 (21%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---- 416 F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 417 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFGT 506 R KIFVGGL S +++ + + +F +FGT Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 679 +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 136 DVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPG 191 Score = 35.9 bits (79), Expect = 0.025 Identities = 11/25 (44%), Positives = 21/25 (84%) Frame = +1 Query: 178 RDDDRKLFVGGLSWETTDKELRDHF 252 + D+ KLF+GG+SW+T ++ L+++F Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYF 26 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/44 (34%), Positives = 28/44 (63%) Frame = +3 Query: 426 HGKIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKERA 557 +GK+F+GG+S + +++ ++ +FS FG + + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEV--IEAVILKDRTTGRA 46 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 121 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 N N S S PGR RK+FVGGL T+ + + +F Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYF 128 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 51.6 bits (118), Expect = 5e-07 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH--- 428 +G++E V D +TGRSRGF ++ F + E + GEH + N+ ++ K A + Sbjct: 26 FGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVATPKEEMR 84 Query: 429 ------GKIFVGGLSSEISDDEIRNFFSEFGTI 509 +IFV + S +S+ + R+ F +G I Sbjct: 85 QPAKKVTRIFVARIPSSVSESDFRSHFERYGEI 117 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/53 (43%), Positives = 29/53 (54%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 670 ++ MP D Q +G FITF S V DL++ +GG V V RATPK D Sbjct: 119 DLYMPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRATPKED 170 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKER 554 KIFVG L E S D++R++F FG I P +R+ R Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHR 281 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 670 D++ + +GF ++TF S + + LK + +G + ++VK ATPK + Sbjct: 37 DRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVATPKEE 82 Score = 31.5 bits (68), Expect = 0.55 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 521 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GP 676 +P D ++ +GF F+TF +E V D + I G+EV + ATP + GP Sbjct: 271 IPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSATPLDEAGP 322 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 401 F +G I+ + DP RGF F+ F D+V A H I ++V Sbjct: 260 FGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-ARRSHEICGQEV 309 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 +V + D N+ +GF F+T++SE V ++++ + K V+VKRA PK Sbjct: 148 DVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPK 198 Score = 35.5 bits (78), Expect(2) = 3e-06 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +3 Query: 420 ARHGKIFVGGLSSEISDDEIRNFFSEFG 503 +R KIFVGGLSS +++E +++F FG Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 33.1 bits (72), Expect = 0.18 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGG++ E S++ ++ +FS +G + Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAV 32 Score = 33.1 bits (72), Expect(2) = 3e-06 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F YG + V + TG+ RGF F+ F + K + H I K VD +KA +H Sbjct: 26 FSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL-RDTHFILGKPVDVRKAIRKH 84 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +1 Query: 190 RKLFVGGLSWETTDKELRDHF 252 +K+FVGGLS TT++E + +F Sbjct: 120 KKIFVGGLSSNTTEEEFKSYF 140 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = +1 Query: 181 DDDR-KLFVGGLSWETTDKELRDHF 252 D DR KLFVGG++ ET+++ L+ +F Sbjct: 2 DYDRYKLFVGGIAKETSEEALKQYF 26 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 35.9 bits (79), Expect(2) = 8e-06 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 348 SIDKVMAAGEHTINNKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI*KWR 521 S V+ AG H N ++ + IFVGG+ ++ D+++R FS+FG + + Sbjct: 292 SSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVK 351 Query: 522 CPLTK 536 P+ K Sbjct: 352 IPVGK 356 Score = 31.1 bits (67), Expect(2) = 8e-06 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVF 335 Y ++S V D NTGRS+G+ F+ F Sbjct: 226 YPSVKSAKVVIDSNTGRSKGYGFVRF 251 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 45.6 bits (103), Expect = 3e-05 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 12/98 (12%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV------- 401 +F A+G I S V DP+ G+S+G+ F+ + E+ + +N+K+V Sbjct: 152 TFSAFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVH 210 Query: 402 ----DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 503 DP K + ++V LS +SD+E+ F EFG Sbjct: 211 KLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFG 248 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 8/96 (8%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV------- 401 +F G++ S+ V D T RS G+ ++ + P+ + + +N + + Sbjct: 64 AFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVR 123 Query: 402 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 DP K+ G IF+ L I + FS FG I Sbjct: 124 DPSLRKSGVGNIFIKNLDKSIDHKALHETFSAFGPI 159 Score = 30.7 bits (66), Expect = 0.96 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 417 KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 K++ ++V L ++DD++R F+ FGTI Sbjct: 323 KSQGSNLYVKNLDESVTDDKLREHFAPFGTI 353 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F +G I S V DP+ G SRG F+ F PE + + Sbjct: 347 FAPFGTITSCKVMRDPS-GVSRGSGFVAFSTPEEATRAI 384 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 44.8 bits (101), Expect = 6e-05 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 8/95 (8%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 404 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 405 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 + + K+FVG L +S+ E+++ FS++GTI Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTI 132 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 44.8 bits (101), Expect = 6e-05 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 8/95 (8%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVD 404 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 405 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 + + K+FVG L +S+ E+++ FS++GTI Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTI 132 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 53 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 108 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 61 DVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 111 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +3 Query: 357 KVMAAGEHTINNKK---VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 K + +H + NK + + KIFVGGL+S +++ E + +F++FG I Sbjct: 6 KAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMI 59 Score = 30.7 bits (66), Expect = 0.96 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 169 APGRDDDRKLFVGGLSWETTDKELRDHF 252 +PG + +K+FVGGL+ T+ E + +F Sbjct: 26 SPGPSNSKKIFVGGLASSVTEAEFKKYF 53 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/63 (33%), Positives = 35/63 (55%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 425 +F +YGEIE +V D +TGR +G+ F++FK + + + E + N+ V A + Sbjct: 427 AFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEK 486 Query: 426 HGK 434 GK Sbjct: 487 PGK 489 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 425 +F YGE+ + D TGRSRGFAF+ F + E M ++ +++ A R Sbjct: 53 AFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/60 (25%), Positives = 33/60 (55%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 688 ++ ++ D+ + +GF F+TF S + ++ ++ + + G+ + V AT + G GG G Sbjct: 61 VDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATERGSGFGGRG 120 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVGG+S + +R FS++G + Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEV 60 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 41.9 bits (94), Expect = 4e-04 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 14/102 (13%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGE------HTIN 389 +F ++G I S V D TGRS+G+ F+ F+ ES IDK+ M + H I Sbjct: 155 TFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIR 213 Query: 390 NKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 ++ D R ++V L EI +DE+R F +FG I Sbjct: 214 RQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVI 255 Score = 37.1 bits (82), Expect = 0.011 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 8/89 (8%) Frame = +3 Query: 267 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT--------INNKKVDPKKAKA 422 + S+ V D N RS G+A+I F P + M A +T I DP + Sbjct: 75 VVSVRVCRDQNR-RSLGYAYINFSNPNDAYRAMEALNYTPLFDRPIRIMLSNRDPSTRLS 133 Query: 423 RHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 G IF+ L + I + + FS FGTI Sbjct: 134 GKGNIFIKNLDASIDNKALFETFSSFGTI 162 Score = 30.7 bits (66), Expect = 0.96 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 347 F YG + S V +P G SRGF F+ + PE Sbjct: 352 FSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPE 383 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 12/99 (12%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKK 413 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 414 AKARHG-------KIFVGGLSSEISDDEIRNFFSEFGTI 509 K G K+FVG L +S+ E+++ FSE+GTI Sbjct: 88 VKYADGELERLEHKLFVGMLPKNVSETEVQSLFSEYGTI 126 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 41.5 bits (93), Expect = 5e-04 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 19/107 (17%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 401 +F YGEIE D +G+S+G+ FI+FK+ + + I + Sbjct: 147 AFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIG 206 Query: 402 ----DPKKAKARH-------GKIFVGGLSSEISDDEIRNFFSEFGTI 509 +P A A+H KI+V +S++I ++ FFS FG I Sbjct: 207 PVQGNPVVAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFSRFGEI 253 Score = 34.7 bits (76), Expect = 0.059 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +GEIE + D TGR +GFA V+++ ES K + T + KA Sbjct: 247 FSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKA 302 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F YGEI V D NTGRS+G+ F+ F+ PE+ + A I+ ++ + Sbjct: 44 FEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRAN 95 Score = 34.7 bits (76), Expect = 0.059 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET + LR HF Sbjct: 25 KVFVGGLAWETQSETLRQHF 44 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E + +R F ++G I Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYGEI 50 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 676 LE + DK + KG+ F+TF + P I G+ + A+ P+P P Sbjct: 51 LEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLASLGRPRPPLP 109 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 40.7 bits (91), Expect = 9e-04 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 34.7 bits (76), Expect = 0.059 Identities = 22/81 (27%), Positives = 40/81 (49%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 429 GKIFVGGLSSEISDDEIRNFF 491 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 482 KLLQ*IWNYLEVE---MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKR 652 +LL Y +VE + FDK + +GF +++ + L P + I GK ++ K Sbjct: 182 RLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKL 241 Query: 653 ATPKPDG 673 A G Sbjct: 242 AVDGKKG 248 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 40.7 bits (91), Expect = 9e-04 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 34.7 bits (76), Expect = 0.059 Identities = 22/81 (27%), Positives = 40/81 (49%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 429 GKIFVGGLSSEISDDEIRNFF 491 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 482 KLLQ*IWNYLEVE---MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKR 652 +LL Y +VE + FDK + +GF +++ + L P + I GK ++ K Sbjct: 182 RLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKL 241 Query: 653 ATPKPDG 673 A G Sbjct: 242 AVDGKKG 248 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 40.3 bits (90), Expect = 0.001 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 10/97 (10%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEHTINNK---K 398 F +G I S V T + G+SRG+ F+ F+ A ++++ + A + K K Sbjct: 132 FKKFGNIVSCKVATLED-GKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKK 190 Query: 399 VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 D K + ++ +++ L +++S+D +R F+EFG I Sbjct: 191 TDRVKPEEKYTNLYMKNLDADVSEDLLREKFAEFGKI 227 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +3 Query: 393 KKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 +K + +K A+ I+V ++ ++++E+R FS+ GTI Sbjct: 292 EKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGTI 330 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/96 (18%), Positives = 44/96 (45%), Gaps = 8/96 (8%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 401 +F + + S+ + D ++GRS + + F + + + + +++ N K+ Sbjct: 43 AFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSVR 102 Query: 402 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 P + G +FV L +++ +++ F +FG I Sbjct: 103 APDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNI 138 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKV 362 G I S + D G+S+GF F+ F P E+ID V Sbjct: 328 GTITSTKLMCDEK-GKSKGFGFVCFSTPEEAIDAV 361 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E DE+R +F +FG I Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEI 43 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGPG 679 LE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 44 LEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPPR 103 Query: 680 GIG 688 G G Sbjct: 104 GRG 106 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET E+R +F Sbjct: 18 KVFVGGLAWETPTDEMRRYF 37 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E DE+R +F +FG I Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEI 43 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGPG 679 LE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 44 LEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPPR 103 Query: 680 GIG 688 G G Sbjct: 104 GRG 106 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET E+R +F Sbjct: 18 KVFVGGLAWETPTDEMRRYF 37 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +GEI V D T RS+GF F+ F+ ES + HTI+ + V+ K A Sbjct: 29 FERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 655 D + KGF F+TF + + P TI G+ V+ K A Sbjct: 43 DGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 401 +F YGEI +V D +TGR++GF F++FK + + E + N+ V Sbjct: 182 AFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 673 E + DK + KGF F+ F++ + LK P++ + + V A P G Sbjct: 191 ECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARPFNSG 244 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 166 EAPGRDDD-RKLFVGGLSWETTDKELRDHF 252 E+ RD R +FV GL W+TT + L+ F Sbjct: 154 ESADRDSSQRNIFVRGLGWDTTHENLKAAF 183 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 350 F YG+I V TD NTGRS+G+ F+ F+ PE+ Sbjct: 44 FDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEA 77 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET + LR HF Sbjct: 25 KVFVGGLAWETQSETLRRHF 44 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E + +R F ++G I Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYGDI 50 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 35.1 bits (77), Expect = 0.045 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 667 +E + +D+ + KGF F+T++S Q V + +K+ + G+++ V A +P Sbjct: 231 VEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARP 284 Score = 34.3 bits (75), Expect(2) = 0.003 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F + G +E + V D TGRSRGF F+ S+ +V AA + N ++D + + Sbjct: 111 FESAGNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQQ-FNGYELDGRPLRVNA 166 Query: 429 G 431 G Sbjct: 167 G 167 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/60 (21%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKVDPKKAKAR 425 F G++ V D ++GRS+GF F+ + + + + + + + ++ +++ +A+AR Sbjct: 224 FSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283 Score = 23.8 bits (49), Expect(2) = 0.003 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 +++VG LS + D + + FSE G + Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKV 230 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 +F YGE+ V D TGRSRGF F+ F + E+ + A Sbjct: 59 AFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKER 554 K+F+GG++ + +D +R F+++G + R L ++ + R Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSR 81 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGGI 685 ++ + D+ + +GF F+TF S + + ++ R + G+ V V A + G GG Sbjct: 67 VDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYANDRTSG-GGF 125 Query: 686 G 688 G Sbjct: 126 G 126 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRD---HFGHTVK*RVLM*RQ 291 KLF+GGLSW T D LRD HFG V +V++ R+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVF 335 +F +G++ V D TGRSRGF F+ F Sbjct: 54 AFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+F+GGLS D +R+ F+ FG + Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDV 61 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRD---HFGHTVK*RVLM*RQ 291 KLF+GGLSW T D LRD HFG V +V++ R+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVF 335 +F +G++ V D TGRSRGF F+ F Sbjct: 54 AFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+F+GGLS D +R+ F+ FG + Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDV 61 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/81 (23%), Positives = 35/81 (43%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 440 GEI + + D ++G S+G+AF+ FK + K + K ++F Sbjct: 140 GEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLF 199 Query: 441 VGGLSSEISDDEIRNFFSEFG 503 +G + ++DE R + G Sbjct: 200 IGNIPKNWTEDEFRKVIEDVG 220 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +3 Query: 426 HG-KIFVGGLSSEISDDEIRNFFSEFGTI 509 HG ++F+GGL ++ ++++R+ E G I Sbjct: 114 HGSEVFIGGLPRDVGEEDLRDLCEEIGEI 142 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +3 Query: 267 IESINVKTDP-NTGRSRGFAFIVF 335 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 350 F +GEI V TD NTGRS+G+ F+ FK E+ Sbjct: 42 FEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVGGL+ E D +R +F +FG I Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGEI 48 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET +R +F Sbjct: 23 KIFVGGLAWETQRDTMRRYF 42 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 395 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 679 E + DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 132 ECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 166 EAPGRD-DDRKLFVGGLSWETTDKEL 240 EA RD RK+FV GL WETT + L Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETL 120 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 395 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 679 E + DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 132 ECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 166 EAPGRD-DDRKLFVGGLSWETTDKEL 240 EA RD RK+FV GL WETT + L Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETL 120 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKA 422 +F YG + V D +GRSRGF FI F +++D+ +AA ++ + + KA+ Sbjct: 26 AFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQP 85 Query: 423 RHG 431 G Sbjct: 86 HQG 88 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/37 (43%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = +1 Query: 181 DDDRKLFVGGLSWETTDKELRDHF---GHTVK*RVLM 282 D + + F+GGL+W T+D+ LRD F GH V+ +V++ Sbjct: 4 DPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVL 40 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 679 +E ++ DK + +GF FITF+ ++ +++ + + G+ + V +A P G G Sbjct: 34 VEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQGGAG 91 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 422 +F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 423 R 425 R Sbjct: 87 R 87 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 682 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGGG 93 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 181 DDDRKLFVGGLSWETTDKELRDHF 252 D + + FVGGL+W T D+ L F Sbjct: 5 DVEYRCFVGGLAWATDDRALETAF 28 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 422 +F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 423 R 425 R Sbjct: 87 R 87 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 682 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGGG 93 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 181 DDDRKLFVGGLSWETTDKELRDHF 252 D + + FVGGL+W T D+ L F Sbjct: 5 DVEYRCFVGGLAWATDDRALETAF 28 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +GEI +NV D T RS+G+ F+ FK ES + TI + + K A Sbjct: 33 FKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLA 88 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 37.5 bits (83), Expect = 0.008 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTK 536 IFVGGL S ++D++++ FSEFG I + P+ K Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGK 341 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 223 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 37.5 bits (83), Expect = 0.008 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 426 HGKIFVGGLSSEISDDEIRNFFSEFGTI 509 H K+FVGGL+ E DE+R +F +FG I Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFGEI 43 Score = 36.3 bits (80), Expect = 0.019 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +GEI + TD TG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 37 FDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKAN 88 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGPG 679 LE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 44 LEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKANCNIASFGRPRPSTPR 103 Query: 680 GIG 688 G G Sbjct: 104 GRG 106 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET E+R +F Sbjct: 18 KVFVGGLAWETPTDEMRRYF 37 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 +F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 32.7 bits (71), Expect = 0.24 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +1 Query: 106 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELRDHF 252 N+L+G G S + G R KLFVGGLSW T D L+ F Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAF 55 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGLS D ++ F+ FG + Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEV 61 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 +F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 32.7 bits (71), Expect = 0.24 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +1 Query: 106 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELRDHF 252 N+L+G G S + G R KLFVGGLSW T D L+ F Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAF 55 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGLS D ++ F+ FG + Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEV 61 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQ 539 +FVGGL + ++DD ++N FS++G I + P K+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKR 297 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQ 539 +FVGGL + ++DD ++N FS++G I + P K+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKR 297 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 350 F YGEI +N+ D TG+S+GFAF+ ++ S Sbjct: 56 FSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 36.3 bits (80), Expect = 0.019 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVD 404 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 405 PKKAKARHGKI 437 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 36.3 bits (80), Expect = 0.019 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVD 404 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 405 PKKAKARHGKI 437 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 368 Y + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 140 YSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 36.3 bits (80), Expect = 0.019 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 8/78 (10%) Frame = +3 Query: 300 TGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKV-------DPKKAKARHGKIFVGGLS 455 T RS G+A++ F PE + M + + I ++ + DP + G +F+ L Sbjct: 81 THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRDPSTRLSGKGNVFIKNLD 140 Query: 456 SEISDDEIRNFFSEFGTI 509 + I + + FS FGTI Sbjct: 141 ASIDNKALYETFSSFGTI 158 Score = 33.1 bits (72), Expect = 0.18 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 24/112 (21%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPE----SIDKV--MAAGEHTI----NNK 395 +F YG+I S V D +G SR F F+ F +PE +++K+ ++ GE + K Sbjct: 244 TFGKYGDISSAVVMKD-QSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQK 302 Query: 396 KVDPKK--------------AKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 K D ++ K + +++ L ++D++++ FSE+G + Sbjct: 303 KSDREEELRRKFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYGNV 354 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 347 F YG + S V + + G SRGF F+ + PE Sbjct: 348 FSEYGNVTSCKVMMN-SQGLSRGFGFVAYSNPE 379 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 36.3 bits (80), Expect = 0.019 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTK 536 IFVGGL S ++D++++ F+EFG I + P+ K Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGK 339 Score = 35.9 bits (79), Expect = 0.025 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +3 Query: 264 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 410 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 411 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 497 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 35.9 bits (79), Expect = 0.025 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQ 539 IFVGGL + ++DDE+++ F +FG + + P K+ Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKR 296 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVF 335 YG ++ V D TGRS+G+ F+ F Sbjct: 178 YGSVKGAKVVLDRTTGRSKGYGFVRF 203 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 148 QDHNSAEAPGRD-DDRKLFVGGLSWETTDKELRDHFG 255 Q+ A A D ++ +FVGGL TD EL+ FG Sbjct: 245 QNTQGANAGDNDPNNTTIFVGGLDANVTDDELKSIFG 281 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 35.9 bits (79), Expect = 0.025 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +3 Query: 264 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 410 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 411 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 497 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 27 FEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E +RN+F +FG I Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDI 33 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET LR++F Sbjct: 8 KVFVGGLAWETHKVSLRNYF 27 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 27 FEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E +RN+F +FG I Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDI 33 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET LR++F Sbjct: 8 KVFVGGLAWETHKVSLRNYF 27 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/59 (27%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKVDPKKAKARHGK 434 G++ +++ DP T SRGF FI K+ ++ + + +H++ + + +KA+ R G+ Sbjct: 99 GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRRRGR 157 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 157 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 + AE PG L+V GLS T+++L DHF Sbjct: 68 SDAENPGNS----LYVTGLSHRVTERDLEDHF 95 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 35.5 bits (78), Expect = 0.034 Identities = 14/82 (17%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPE-SIDKVMAAGEHTINNKKVDPKKAKARHGKI 437 GE+ + + + ++G +G+AF+ F++ + + + + K++ +A+H ++ Sbjct: 116 GEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIKCSTTQAKH-RL 174 Query: 438 FVGGLSSEISDDEIRNFFSEFG 503 F+G + + +I+ + G Sbjct: 175 FLGNVPRNWMESDIKKAANRIG 196 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 35.5 bits (78), Expect = 0.034 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 368 +F ++G++ V TD ++GRS+GF F+ + E +K A Sbjct: 53 AFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 35.1 bits (77), Expect = 0.045 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F YG + S+ V D GRSRGF F+ F PE+ K M Sbjct: 222 FSQYGTVSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 Score = 31.5 bits (68), Expect = 0.55 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 12/99 (12%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-------GEHTINNKKVDP 407 F +G I S V + G+S+GF F+ F +S +A G+ K ++ Sbjct: 132 FCPFGSILSCKVVEE--NGQSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFVAKFINK 189 Query: 408 KKAKARHGK-----IFVGGLSSEISDDEIRNFFSEFGTI 509 + A G ++V L ++DD + FS++GT+ Sbjct: 190 DERAAMAGNQDSTNVYVKNLIETVTDDCLHTLFSQYGTV 228 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVF 335 F YG+I S V N GRS+GF F+ F Sbjct: 324 FGCYGQIVSAKVMCHEN-GRSKGFGFVCF 351 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 35.1 bits (77), Expect = 0.045 Identities = 17/56 (30%), Positives = 32/56 (57%) Frame = +3 Query: 369 AGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTK 536 AG H N D ++ + IFVGGL ++++++++ FS+FG + + P+ K Sbjct: 310 AGGHGGNGSMSD---GESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGK 362 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVF 335 Y ++ V D NTGRS+G+ F+ F Sbjct: 237 YPSVKGAKVVIDSNTGRSKGYGFVRF 262 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 34.7 bits (76), Expect = 0.059 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +3 Query: 420 ARHG-KIFVGGLSSEISDDEIRNFFSEFGTI 509 A+ G +IFVGGLS E++D ++ FS FG I Sbjct: 3 AKEGSRIFVGGLSPEVTDRDLERAFSRFGDI 33 Score = 34.3 bits (75), Expect = 0.078 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTINNKKVDP 407 +F +G+I + + +TGRSRGF FI F ++D+ + G+ I+ + +P Sbjct: 26 AFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEP 85 Query: 408 K 410 K Sbjct: 86 K 86 Score = 31.1 bits (67), Expect = 0.73 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 664 L+ ++ ++ + +GF FITF + +++ ++ R G + + V RA PK Sbjct: 34 LDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 34.7 bits (76), Expect = 0.059 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 21/108 (19%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKK 413 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 414 AKARHG----------------KIFVGGLSSEISDDEIRNFFSEFGTI 509 K G K+FVG L +S+ E+++ FSE+GTI Sbjct: 88 VKYADGELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGTI 135 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 34.7 bits (76), Expect = 0.059 Identities = 34/112 (30%), Positives = 49/112 (43%), Gaps = 25/112 (22%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEH--------- 380 F +G + S+ V +P TG SRG ++ A S+D G Sbjct: 128 FQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDM 187 Query: 381 ---TINNKKV---DPKKA---KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 T N +V PKK +++H K++VG L D +RN FS+FGTI Sbjct: 188 NPGTRRNPEVLNSTPKKILMYESQH-KVYVGNLPWFTQPDGLRNHFSKFGTI 238 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 368 F +G I S V D TGR+R FAF+ F + E D ++ Sbjct: 232 FSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 34.3 bits (75), Expect = 0.078 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVF 335 F A+G +E + + DP TG+ +GF FI F Sbjct: 285 FEAFGPVELVQLPLDPETGQCKGFGFIQF 313 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 34.3 bits (75), Expect = 0.078 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 +F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 682 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGG 91 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 + FVGGL+ +D++++ FS+FG + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDV 32 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 + FVGGL+W T D++L+ F Sbjct: 7 RCFVGGLAWATNDEDLQRTF 26 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 34.3 bits (75), Expect = 0.078 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 +F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGGIG 688 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG G Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGGGG 93 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 + FVGGL+ +D++++ FS+FG + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDV 32 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 + FVGGL+W T D++L+ F Sbjct: 7 RCFVGGLAWATNDEDLQRTF 26 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 34.3 bits (75), Expect = 0.078 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 +F +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGGIG 688 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG G Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGGGG 93 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 + FVGGL+ +D++++ FS+FG + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDV 32 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 + FVGGL+W T D++L+ F Sbjct: 7 RCFVGGLAWATNDEDLQRTF 26 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 34.3 bits (75), Expect = 0.078 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 527 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 667 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKA 341 +F YGEIE D +G+S+G+ FI++K+ Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 34.3 bits (75), Expect = 0.078 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 527 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 667 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKA 341 +F YGEIE D +G+S+G+ FI++K+ Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 34.3 bits (75), Expect = 0.078 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 527 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 667 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKA 341 +F YGEIE D +G+S+G+ FI++K+ Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 34.3 bits (75), Expect = 0.078 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 3/50 (6%) Frame = +1 Query: 142 DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELR---DHFGHTVK*RVLM 282 DS+D + +E+P +KLF+ GLS+ T++K LR + FG V+ +++M Sbjct: 267 DSRDQDDSESPPVKT-KKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIM 315 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 350 +F +GE+ + + D + RS+G+AF+ + E+ Sbjct: 301 AFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEA 335 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 34.3 bits (75), Expect = 0.078 Identities = 19/85 (22%), Positives = 37/85 (43%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F GE+ + + +P T +S+G AF+ F E + + + + N K A + Sbjct: 234 FGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDN 293 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFG 503 +FVG + + + +R +G Sbjct: 294 DTLFVGNICKIWTPEALREKLKHYG 318 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKA 416 G++ S V P T +S GF F+ F + E ++ ++A + +K+ KA Sbjct: 201 GKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 +G +E + V D +GRSR F F K+ E + V+ Sbjct: 99 HGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV 134 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 33.9 bits (74), Expect = 0.10 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVF 335 +F ++GE+ + + D +GRSRGF F+ F Sbjct: 60 AFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKER 554 K+F+GGLS + + +++ FS FG + + R K + R Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSR 82 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 KLF+GGLSW ++ L+D F Sbjct: 42 KLFIGGLSWSVDEQSLKDAF 61 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 368 G ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 33.9 bits (74), Expect = 0.10 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 413 +F YG I S V D + G+SR F F+ F+ PE + + A +N KK D K+ Sbjct: 244 TFGQYGSISSAVVMRDGD-GKSRCFGFVNFENPEDAARAVEA----LNGKKFDDKE 294 Score = 30.7 bits (66), Expect = 0.96 Identities = 20/90 (22%), Positives = 38/90 (42%), Gaps = 8/90 (8%) Frame = +3 Query: 264 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--------DPKKAK 419 ++ S+ V D T S G+ ++ + + +K M ++ N K+ D + Sbjct: 71 QVVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKLNYSYLNGKMIRITYSSRDSSARR 130 Query: 420 ARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 + G +FV L + + + FS GTI Sbjct: 131 SGVGNLFVKNLDKSVDNKTLHEAFSGCGTI 160 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 255 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 ++G + N+ D TG S+G+AF V++ P D AA Sbjct: 397 SFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 422 +F YG+I + +TGR RGF FI F D + + NK + KA+ Sbjct: 31 TFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEP 90 Query: 423 RHG 431 + G Sbjct: 91 KVG 93 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 673 E ++ + + +GF FITF + +D +K R +G K + V +A PK G Sbjct: 40 ECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 31.1 bits (67), Expect = 0.73 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 187 DRKLFVGGLSWETTDKELRDHF 252 + ++FVGGLSW+ T+++L F Sbjct: 11 ESRIFVGGLSWDVTERQLESTF 32 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 +IFVGGLS ++++ ++ + F +G I Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKI 38 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKA 422 +F YG+I + +TGR RGF FI F D + + NK + KA+ Sbjct: 31 TFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEP 90 Query: 423 RHG 431 + G Sbjct: 91 KVG 93 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 673 E ++ + + +GF FITF + +D +K R +G K + V +A PK G Sbjct: 40 ECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 31.1 bits (67), Expect = 0.73 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 187 DRKLFVGGLSWETTDKELRDHF 252 + ++FVGGLSW+ T+++L F Sbjct: 11 ESRIFVGGLSWDVTERQLESTF 32 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 +IFVGGLS ++++ ++ + F +G I Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKI 38 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 402 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 +P++ + GKIFVG L + I E FF +FG I Sbjct: 156 NPQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFGPI 191 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/98 (20%), Positives = 44/98 (44%), Gaps = 11/98 (11%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKV 401 F +G + + + D TG+ +G F+ + + D+ + A G + + Sbjct: 140 FEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYA 199 Query: 402 DPKKAK--ARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 D ++ + K+FVG L+ + ++ E+ F +FG + Sbjct: 200 DGERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHV 237 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/98 (20%), Positives = 44/98 (44%), Gaps = 11/98 (11%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKV 401 F +G + + + D TG+ +G F+ + + D+ + A G + + Sbjct: 140 FEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYA 199 Query: 402 DPKKAK--ARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 D ++ + K+FVG L+ + ++ E+ F +FG + Sbjct: 200 DGERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHV 237 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 297 NTGRSRGFAFIVFKAPESIDKVMA 368 NTGRSRGF FI F++ E++ +A Sbjct: 255 NTGRSRGFGFISFESAENVQSALA 278 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = +3 Query: 345 ESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 E +++ GE + +K +A G+++VG L I+ E+ F E GT+ Sbjct: 89 EEVEEEGDEGEEEVEEEK-QTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTV 142 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/79 (24%), Positives = 35/79 (44%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F G + + + D T RSRGF F+ + E + M N+ ++ + K Sbjct: 136 FGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAM----QMFNSSQIGGRTVKVNF 191 Query: 429 GKIFVGGLSSEISDDEIRN 485 ++ GG +E+ +IR+ Sbjct: 192 PEVPRGG-ENEVMRTKIRD 209 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 181 DDDRKLFVGGLSWETTDKELRDHFG 255 D K++ G L W T + L+D FG Sbjct: 216 DSPHKVYAGNLGWNLTSQGLKDAFG 240 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDV 646 ++V++ +DK ++ +GF F+T S E+ + IGG+ V V Sbjct: 143 VDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 33.5 bits (73), Expect = 0.14 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +3 Query: 246 SFWAYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 395 +F A+G I S + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 131 TFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 Score = 32.3 bits (70), Expect = 0.31 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 7/90 (7%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESID---KVMAA----GEHTINNKKVDPKKAK 419 G + ++ V D T + + FI +++ E D KV+ G+ NK KK+ Sbjct: 49 GPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRVNKASQDKKSL 108 Query: 420 ARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 +F+G L ++ + + + FS FG I Sbjct: 109 DVGANLFIGNLDPDVDEKLLYDTFSAFGVI 138 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 353 F +GE+ + D TGRS+GF F+ FK +S+ Sbjct: 64 FNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 688 D+ + KGF F+TF+ E D ++T + G+E+D + T + G G G Sbjct: 78 DRETGRSKGFRFVTFKDE----DSMRTAIDRMNGQELDGRNITAQARGSGTRG 126 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPL 530 K++VGG+ + ++DEIR++F G I K C + Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKM 194 Score = 29.1 bits (62), Expect = 2.9 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +1 Query: 181 DDDRKLFVGGLSWETTDKELRDHFGHTV 264 D ++++G L+W+TT++++R F V Sbjct: 259 DGYNRVYIGNLAWDTTERDIRKLFSDCV 286 Score = 28.3 bits (60), Expect = 5.1 Identities = 9/20 (45%), Positives = 17/20 (85%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 KL+VGG+ +++T+ E+R +F Sbjct: 162 KLYVGGIPYQSTEDEIRSYF 181 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 31.5 bits (68), Expect = 0.55 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E + ++ F +FG I Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEI 39 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 31.5 bits (68), Expect = 0.55 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E + ++ F +FG I Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEI 39 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 31.5 bits (68), Expect = 0.55 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E + ++ F +FG I Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEI 39 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 32.3 bits (70), Expect = 0.31 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 F +G++ V +D TGRSRGF F+ ++ +AA Sbjct: 227 FSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Score = 31.5 bits (68), Expect = 0.55 Identities = 23/97 (23%), Positives = 40/97 (41%), Gaps = 14/97 (14%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKARHG-- 431 G +E V + +T +SRGF F+ E +K V +N +++ +A R Sbjct: 137 GTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRP 196 Query: 432 -----------KIFVGGLSSEISDDEIRNFFSEFGTI 509 +I+VG L ++ + FSE G + Sbjct: 197 ERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKV 233 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 368 F +G + S V DPN G S+G F+ F PE + M+ Sbjct: 152 FSPFGTVTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 Score = 31.1 bits (67), Expect = 0.73 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 24/112 (21%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAAGEHTINNKK-------- 398 +F YG+I S V D G+S+GF F+ F+ A ++ V + H ++K+ Sbjct: 48 AFGEYGKITSAVVMKD-GEGKSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQK 106 Query: 399 -------------VDPKKA--KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 + K+A K + ++V L ISD++++ FS FGT+ Sbjct: 107 KSERETELRVRYEQNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTV 158 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +3 Query: 354 DKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 DK + G + ++ D K + ++V L+ +DD+++N F E+G I Sbjct: 5 DKQVYVGPF-LRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKI 55 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 32.3 bits (70), Expect = 0.31 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFI 329 GE+ ++V TD TG SRGFA+I Sbjct: 507 GEVTRVHVPTDRETGASRGFAYI 529 Score = 30.7 bits (66), Expect = 0.96 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +3 Query: 336 KAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 K ++ V A + K + + +F G LS +I+ +I NFF E G + Sbjct: 353 KKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAGEV 410 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 32.3 bits (70), Expect = 0.31 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFK 338 SF A+ V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFK 338 +F +G++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 Score = 28.7 bits (61), Expect = 3.9 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 + FVGGL+ +D++++ FS+FG + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDV 32 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 + FVGGL+W T D++L+ F Sbjct: 7 RCFVGGLAWATNDEDLQRTF 26 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGG 631 D+ + +GF F+TF+ E+ + D ++ + GG Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGSGGG 73 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 F +G++ V D TGRSRGF F+ + +++ ++A Sbjct: 264 FSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/112 (19%), Positives = 46/112 (41%), Gaps = 14/112 (12%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHGK- 434 G +E V + T +SRGF F+ + + + + + +N + + KA R + Sbjct: 174 GTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRP 233 Query: 435 ------------IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKER 554 ++VG L ++ + + FSE G + + R ++ + R Sbjct: 234 ERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSR 285 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 31.5 bits (68), Expect = 0.55 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG--------EHTINNKKVD 404 F +G ++ + V + TG+S+ F FI F+ PE + +AAG EH + ++ Sbjct: 80 FSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAE--IAAGAMNDYLLMEHMLKVHVIE 137 Query: 405 PKKAK 419 P+ K Sbjct: 138 PENVK 142 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKER 554 +++G + + EI FFS+FGT+ + R K+ K + Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSK 101 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 31.5 bits (68), Expect = 0.55 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVGGL+W+T + + DHF Sbjct: 18 KVFVGGLAWDTHKEAMYDHF 37 Score = 30.7 bits (66), Expect = 0.96 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 F YG+I + +D T RS+G+ F+ FK ++ + IN ++ + Sbjct: 37 FIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRRAN 88 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 380 +G + + V + N+G SRGFAFI F ++ +M EH Sbjct: 321 WGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 Score = 31.1 bits (67), Expect = 0.73 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKAK 419 F + I+ + + D T SRGFAF+ F + E K + A T N K + AK Sbjct: 478 FSKHAPIKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAK 537 Query: 420 ARHG 431 + HG Sbjct: 538 SVHG 541 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 356 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/56 (23%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 425 G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 273 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 667 +E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 276 VEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 329 Score = 28.3 bits (60), Expect = 5.1 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Frame = +1 Query: 118 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF---GHTVK* 270 G+ +GGG S S G +L+VG LSW D L + F G V+ Sbjct: 219 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEA 278 Query: 271 RVL 279 RV+ Sbjct: 279 RVI 281 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 356 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/56 (23%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 425 G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 281 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 667 +E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 284 VEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 337 Score = 28.3 bits (60), Expect = 5.1 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Frame = +1 Query: 118 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF---GHTVK* 270 G+ +GGG S S G +L+VG LSW D L + F G V+ Sbjct: 227 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEA 286 Query: 271 RVL 279 RV+ Sbjct: 287 RVI 289 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 31.5 bits (68), Expect = 0.55 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 +F ++G+I V D +G SRGF F+ + + E + M A + NK++D Sbjct: 55 AFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA----MQNKELD 103 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGG 682 D+ +GF F+T++S +V N+ ++ + + G+ + V A G GG Sbjct: 70 DRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPADSGGGGGGG 121 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 +F ++ + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 50 AFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +3 Query: 267 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 419 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 527 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 682 F +T+ G C F+ FE V + +K +GG++V ++ P P G G Sbjct: 289 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRG 342 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 527 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 682 F +T+ G C F+ FE V + +K +GG++V ++ P P G G Sbjct: 348 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRG 401 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGI 685 +E ++ D+ ++ KGF F+TF S ++ L++ + + G+ + V A K GG Sbjct: 61 VEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAKQSLGGGG 120 Query: 686 G 688 G Sbjct: 121 G 121 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKA 422 +F G++ + D + RS+GF F+ F + + K +M +N + + AKA Sbjct: 53 AFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKA 112 Query: 423 R 425 + Sbjct: 113 K 113 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF---GHTVK*RVLM*R 288 KLF+GGLS+ TT++ L + F G V+ +++M R Sbjct: 35 KLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDR 69 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 31.1 bits (67), Expect = 0.73 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 24/118 (20%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN---------NKK-- 398 Y ++ V D TGRS+G+ F+ F + M G++ + NKK Sbjct: 197 YSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQYCSSRPMRTGPAANKKPL 256 Query: 399 -VDPKKAKARHGK----------IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQ 539 + P + G IFVG + +++D++++ F +FG + + P K+ Sbjct: 257 TMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKR 314 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 434 G ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 675 GGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 434 G ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 675 GGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 +F YG++ ++V D R +GFA++ F + E +K + Sbjct: 40 AFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKAL 79 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEV 640 L+V++ DK + + KGF ++TF S E+ LL+ + + G+ V Sbjct: 48 LKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 386 F ++GEI + V TG S G+A+I K E +K + G H + Sbjct: 258 FSSFGEITRVFVPPSHGTGGSLGYAYIDLK--EGAEKALELGRHDV 301 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 +F +GEI+++N+ D +G +G+A I ++ E ++A Sbjct: 114 AFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISA 155 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 401 G++ +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 69 GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 157 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 + AE PG L+V GLS T+++L DHF Sbjct: 38 SDAENPGNS----LYVTGLSHRVTERDLEDHF 65 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 30.7 bits (66), Expect = 0.96 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPK 410 +F YG + V D T RSRGF F+ + + + ++ + +N ++V K Sbjct: 22 AFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 +++VG LS +DD +R FS +G + Sbjct: 4 RVYVGNLSPTTTDDMLREAFSGYGNV 29 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 30.7 bits (66), Expect = 0.96 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFK 338 SF + V D TGRSRGF F+ F+ Sbjct: 163 SFSVFSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 30.7 bits (66), Expect = 0.96 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 12/92 (13%) Frame = +3 Query: 270 ESINVKTDPNTGRSRGFAFIVFKAPE-------SIDKVMAAGEHTINNKKVDPKKAK--- 419 E + V + +TG+SRGFAF+ E ++D G N PK K Sbjct: 112 ELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPL 171 Query: 420 --ARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVG LS ++ + + F E G + Sbjct: 172 YPETEHKLFVGNLSWTVTSESLAGAFRECGDV 203 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 +F G++ V D +TGRSRG+ F+ + + ++ + Sbjct: 196 AFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETAL 235 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 181 DDDRKLFVGGLSWETTDKELRDHF 252 + + KLFVG LSW T + L F Sbjct: 174 ETEHKLFVGNLSWTVTSESLAGAF 197 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 30.7 bits (66), Expect = 0.96 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVF 335 F + GEI++++V D +TG S+G A++ F Sbjct: 425 FSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +1 Query: 109 QLNGNAENGGGDSQDHN---SAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 ++ AE G SQD + SA D R ++VG + + T +E++ HF Sbjct: 73 EMQAKAEKDMGASQDPSGGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHF 123 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F +G + + V D TG SRGF F+ F + E + + Sbjct: 233 FHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAI 271 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 KIFVG L+ + D++R +F +FG + Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFGQV 38 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 K+FVG L+W TT +LR +F Sbjct: 13 KIFVGNLTWRTTADDLRRYF 32 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/65 (23%), Positives = 30/65 (46%) Frame = +3 Query: 315 GFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFS 494 G I + I V+ + + ++ P + K++V GLS ++D +R+ F Sbjct: 39 GTGVISARRRRDIGGVLISSCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFE 98 Query: 495 EFGTI 509 +FG + Sbjct: 99 QFGNL 103 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 193 KLFVGGLSWETTDKELRDHF 252 KL+V GLS+ TT+ LRD F Sbjct: 78 KLYVSGLSFRTTEDTLRDTF 97 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 372 GEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 GE NN + + + + VG +SS + D E++ F +FG I Sbjct: 198 GERGGNNSVGELNRGEIPSRTLLVGNISSNVEDYELKVLFEQFGDI 243 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 368 F +GE+ + TDP TG+ G A+I F E+ + ++ Sbjct: 536 FNKFGEVLKAFIVTDPATGQPSGSAYIEFTRKEAAENALS 575 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 392 F +G++ + V D +T +SRG AF+++ + E K + + I N Sbjct: 77 FSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILN 124 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +1 Query: 115 NGNAENGG--GDSQDHNSAEAPGRDDDR 192 +GN E G GD D++ + PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAA 371 F +GE+ES+++ T R G AF+ FK A S+ + AA Sbjct: 581 FTVFGEVESLSLVLHKVTKRPEGTAFVKFKTADASVAAISAA 622 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKA 422 +F G + + T+ + RGFAF+ F E +++ + T+ +++ K+A Sbjct: 39 AFSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAH 98 Query: 423 R 425 R Sbjct: 99 R 99 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 347 F A+GEI + + D RS+G+AFI F + + Sbjct: 60 FSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQD 92 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 73 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 192 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 162 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +2 Query: 530 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKE--VDVKRAT 658 D T + KGF F FES E ++ + +RTI G+E V+V +AT Sbjct: 237 DPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNVNQAT 282 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFK 338 F Y V D TGRSRGF F+ F+ Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSFR 188 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 368 +F +GE+ V TD +G S+GF F+ + E K +A Sbjct: 75 AFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIA 115 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVF 335 F +YG I+ +++ TD T + +G+AFI + Sbjct: 158 FESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 115 NGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 246 +G AE+GGG S SA A +DD G + E+RD Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDDELAI--GTGYRLPPPEIRD 119 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 139 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 G + + + E+P R L+VGGL+ ++++RD F Sbjct: 211 GKAGEMGTLESPEDQSIRTLYVGGLNSRVLEQDIRDQF 248 >At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger) family protein low similarity to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 375 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -3 Query: 687 PMPPGPSGFGVARFTSTSFP--PIVLLGVLSKSFTTCS 580 P PP P F A T TSFP + ++G+L+ +F S Sbjct: 16 PPPPPPPIFHRASSTGTSFPILAVAVIGILATAFLLVS 53 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKE 551 +FV G S +S+ ++ FSEFG + + + +RT++ Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKI-IANERTRQ 97 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKE 551 +FV G S +S+ ++ FSEFG + + + +RT++ Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKI-IANERTRQ 116 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 115 NGNAENGGGDSQDHNSAEAPGRD--DDRKLFVGGLSWETTDKELRDHF 252 +G+A GD + ++A D D +LFV L + T++EL +HF Sbjct: 234 DGDAMEVEGDGKVAQESKAVSDDVLDTGRLFVRNLPYTATEEELMEHF 281 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F +G+I+ + D T R +GF FI F + + K + Sbjct: 27 FSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKAL 65 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGGIG 688 E + D + KGF FITF+SE LK+ + + G+ + V+ A + GI Sbjct: 35 EARLIRDSETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEVAKNAEEVRAGIN 94 Query: 689 T 691 + Sbjct: 95 S 95 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 +++VG L +S+D++R F FG++ Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSV 311 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +3 Query: 438 FVGGLSSEISDDEIRNFFSEFGTI 509 +VG L S+ +++++N FS+FG + Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDV 34 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +1 Query: 139 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 G + + + E+P + + L+VGGL+ ++++RD F Sbjct: 211 GKAGEMGTLESPDDESIKTLYVGGLNSRILEQDIRDQF 248 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 655 D+ + KGF FITFESE LK + + G+ + V+ A Sbjct: 100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI 509 +FV G S +S+ ++ FSEFG + Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQV 84 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F +G + +V D T SRGF F+ F + E + + Sbjct: 194 FRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWR 521 ++VGG+ +S D++ FS+FG I +R Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKIEDFR 280 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVM 365 F +G + + D +TG+SR F F+ F+ +S+ D +M Sbjct: 27 FSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAIM 66 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 402 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 DP + G +FV L I + ++ + FS FG + Sbjct: 22 DPSNRMSGRGNVFVKNLDESIDNKQLCDMFSAFGKV 57 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +1 Query: 100 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 249 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +1 Query: 100 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 249 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +1 Query: 100 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 249 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At5g22830.1 68418.m02669 magnesium transporter CorA-like family protein weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein; supporting cDNA gi|12007446|gb|AF322255.1|AF322255 Length = 459 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 67 ANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAEAPGRDDDRKL 198 A + A+D D + LN + ++ G DS + GRDD +K+ Sbjct: 65 AKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKI 109 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 255 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 255 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 255 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 425 F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K + Sbjct: 176 FSTFGPVQDVRIPYQ----QKRMFGFVTFMYPETVKSILAKGNPHFVCHSRVLVKPYKEK 231 Query: 426 HGKI 437 GK+ Sbjct: 232 -GKV 234 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 542 NQRKGFCF--ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 688 N+++GFCF + FE+ L+ TIG ++ V+ G G G Sbjct: 329 NKQQGFCFGFVEFETSSGKQSALEASPVTIGDRQAVVEEKKTNSRGGGNNG 379 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 303 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 401 G SRGFAFI F++ +S + M + + +K+ Sbjct: 54 GESRGFAFIEFESADSAGRAMLHMDGRLIGQKI 86 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 139 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 G S+ + + + L+V GLS TDK+L HF Sbjct: 55 GRSRSRSRGRSEVENPGTTLYVTGLSTRVTDKDLEAHF 92 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 425 F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K + Sbjct: 279 FSTFGPVQDVRIPYQ----QKRMFGFVTFVYPETVKSILAKGNPHFVCDSRVLVKPYKEK 334 Query: 426 HGKI 437 GK+ Sbjct: 335 -GKV 337 >At2g33440.1 68415.m04099 splicing factor family protein similar to Splicing factor U2AF 65 kDa subunit (U2 snRNP auxiliary factor large subunit) {Homo sapiens} SP|P26368, {Mus musculus} SP|P26369; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 247 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI*KWR 521 KIF+GG S IS + + S FG + +R Sbjct: 41 KIFIGGFSKAISSEMLMEIVSVFGPLKAYR 70 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 282 VKTDPNTGRSRGFAFIVFK 338 V D TGRSRGF F+ F+ Sbjct: 183 VMWDQKTGRSRGFGFVSFR 201 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,946,995 Number of Sequences: 28952 Number of extensions: 346359 Number of successful extensions: 1730 Number of sequences better than 10.0: 170 Number of HSP's better than 10.0 without gapping: 1225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1706 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -