BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0773 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_19699| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 30.7 bits (66), Expect = 0.81 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 245 QTDFHSKLEGNRTLSVLFLAKEHALQNLPLDQKFDPLRRK 364 Q F+ K + +RT + + H++QN+P+ +P+RR+ Sbjct: 866 QFKFNGKTKASRTPPNQPIERSHSMQNIPIAPNTEPIRRR 905 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 28.3 bits (60), Expect = 4.3 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 147 ARSTPVTGRPGIAVPPGSALRIPLSHSLVPI 239 ARS+PV G A P S+ +P SH VPI Sbjct: 3128 ARSSPVHFNLGRAQSPSSSSLLPRSHEPVPI 3158 >SB_19699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 716 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +2 Query: 215 FITLSGSYTRQTDFHSKLEGNRTLSVLFLAKEHALQNLPLDQKFD 349 +IT S R T+ HS + R+L LF K+ + + + FD Sbjct: 654 YITSPSSVLRWTELHSTAQNRRSLLSLFKVKKLMIMVMAMMNGFD 698 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,962,590 Number of Sequences: 59808 Number of extensions: 311719 Number of successful extensions: 822 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -