BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0751 (807 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 25 0.94 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.2 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.7 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 24.6 bits (51), Expect = 0.94 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 769 FNG*GPFTLAARCGMTNPWISSASSTVPPI 680 F+ G A++ T+ W+SS S VPP+ Sbjct: 88 FSSIGGGISASKRQRTDDWLSSPSGNVPPL 117 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 267 ETNECYSSSCKNVGRIISCSRY*SW*WNNISSCYCWCVVGF 389 + NEC S+ C N G + C + ++ +C C +GF Sbjct: 298 DINECLSNPCSNAG-TLDCVQL-------VNDYHCNCKLGF 330 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 184 CADGISNSFCGIYVAQSD 131 C+DG S S+C + + D Sbjct: 172 CSDGYSGSYCQTEINECD 189 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 267 ETNECYSSSCKNVG 308 E NEC S+ C+N G Sbjct: 184 EINECDSAPCQNGG 197 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 578 FGTHCSASNSSSNGTY 625 FG H AS GTY Sbjct: 346 FGVHAPASGGGKEGTY 361 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -1 Query: 297 CSWMNNTHLFQNCCSSLVIVTSPL 226 C W NT + S++ T+P+ Sbjct: 2276 CDWPENTECHPDASSTMAPSTTPM 2299 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,196 Number of Sequences: 336 Number of extensions: 3955 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -