BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0728 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-tran... 26 1.1 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 6.0 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 23 8.0 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 23 8.0 >AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-transferase protein. Length = 222 Score = 26.2 bits (55), Expect = 1.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 263 PVLLRTDRLQQDHRCYQRAHP 201 P++LR DR + H ++ AHP Sbjct: 190 PIILRIDRELEGHPAFRAAHP 210 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 27 PPTKVVSTPLDAFSLARLLPDKKLASWDQTLHLERKRTC 143 P VV+ P+DA S A L+ + T LE R C Sbjct: 89 PGNMVVAGPIDAGSCALLMAQLQNIGAQLTTALEELRLC 127 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 561 VAEESDQLCLSKSPNKHNRLFMKAQPMP 644 V + LC + SPN + + QP P Sbjct: 154 VNSRGNTLCAASSPNAYTNTTIAVQPAP 181 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +1 Query: 499 EEDLLAFQSRSLTLSCRTVRP*LRNRTSSVSQSRPTSTTVC 621 E D+L + +T+ V P T++ + + PT+ T C Sbjct: 272 EYDVLQAAAAKMTVCEVAVEPPAMTTTTTTTTTTPTTATAC 312 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 860,443 Number of Sequences: 2352 Number of extensions: 17459 Number of successful extensions: 64 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -