BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0717 (607 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 8.1 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 21 8.1 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.0 bits (42), Expect = 8.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 352 NVLERGLFC 326 N +ERGLFC Sbjct: 128 NCIERGLFC 136 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -2 Query: 276 LQQRLHVSTELLFELTDKPDLDLLKGIQFRHRHIDD 169 +Q+R+ E F KPD L+ +++ R I + Sbjct: 18 IQERIFEEIEETFSDDTKPDYKSLQELKYMERCIKE 53 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,189 Number of Sequences: 336 Number of extensions: 2724 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -