BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0595 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52615| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_56371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_51317| Best HMM Match : E-MAP-115 (HMM E-Value=0.58) 29 4.8 SB_40974| Best HMM Match : KE2 (HMM E-Value=0.88) 29 4.8 SB_16001| Best HMM Match : LRR_1 (HMM E-Value=0.035) 29 4.8 SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_46169| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_24047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) 28 8.4 >SB_52615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1154 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/73 (26%), Positives = 36/73 (49%) Frame = +2 Query: 278 PHPMTMALSVLVTIEMLNAMNSLSENQSLVTMPPWSNLWLVGSMALSFTLHFVILYVEVL 457 P TM + V +M NA++ S+ +S+ + +N + ++ S F+++Y L Sbjct: 849 PRDTTMTFTCFVFFDMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPL 908 Query: 458 SAVFQVTPLSLDE 496 AVFQ L + + Sbjct: 909 QAVFQTEALHITD 921 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 6 PATALGFNPPDLDIMDKPPRKADEGLIS 89 PA +LG P D D+M +PPR +I+ Sbjct: 789 PAQSLGVEPVDSDVMRRPPRNVKSPMIT 816 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 6 PATALGFNPPDLDIM 50 PATAL FNPPD DIM Sbjct: 805 PATALSFNPPDSDIM 819 >SB_56371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1035 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 390 KFDQGGMVTRDWFSDKLFMAFN 325 KFD+ G++ R WFSD FN Sbjct: 607 KFDKHGVMGRKWFSDSTVQQFN 628 >SB_51317| Best HMM Match : E-MAP-115 (HMM E-Value=0.58) Length = 696 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 490 ERQRRHLEHGRKNLDVEDDEMKSEGERHGADEPQ 389 E QRRH+ G +++ ED + HGA P+ Sbjct: 280 ELQRRHIHVGSRDVAEEDTQSTGLASSHGAASPE 313 >SB_40974| Best HMM Match : KE2 (HMM E-Value=0.88) Length = 106 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 490 ERQRRHLEHGRKNLDVEDDEMKSEGERHGADEPQ 389 E QRRH+ G +++ ED + HGA P+ Sbjct: 66 ELQRRHIHVGSRDVAEEDTQSTGLASSHGAASPE 99 >SB_16001| Best HMM Match : LRR_1 (HMM E-Value=0.035) Length = 277 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 529 PRVLRTSYGYPLVERQRRHLEHGRKNLDVED 437 PRV R GY L ++ LE G +N D ED Sbjct: 103 PRVRRAPKGYKLEAVRKLELEEGMENSDEED 133 >SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 666 SVDDDAKEDGPHEHNPLHAVEPV*DSARL 580 SV D+ +D +HNPLH P +A+L Sbjct: 427 SVTDETNKDPVDKHNPLHNASPTPPTAQL 455 >SB_46169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 260 SQTLKFITTADTL*VMSELPVCHLRSVRGVHEPPGGSADC 141 SQ FI+ D L ++PVC+L G PG ++ C Sbjct: 24 SQPGVFISIIDLLDEDQDMPVCNLTKDAGARVSPGDNSGC 63 >SB_24047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2905 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 508 MKFSVPVVLLDEVLKFVARKISDGETRTVLDWLH-GMQWIV 627 +KF L ++ +++ I +G T LDW H M W++ Sbjct: 1221 LKFKRRTRFLGFFVQVLSKAIDEGMMETALDWTHDAMTWVI 1261 >SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) Length = 1021 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = -1 Query: 508 YGYPLVERQRRHLEHGRKNLDVEDDEMKSEGERHGADEPQV*PGR 374 +G VE + ++HG+KN++ E +M+ + G +E + G+ Sbjct: 270 HGKKNVEHEEGDMQHGKKNMEHEKGDMQHGKKNMGHEEGDMQHGK 314 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,635,012 Number of Sequences: 59808 Number of extensions: 478938 Number of successful extensions: 1361 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1352 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -