BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0812 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 232 2e-61 SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.054 SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) 32 0.38 SB_58702| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.059) 30 2.0 SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) 30 2.0 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 29 3.5 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 3.5 SB_47997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 28 6.2 SB_671| Best HMM Match : Pneumo_matrix (HMM E-Value=3.9) 28 6.2 SB_48995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_19577| Best HMM Match : SERTA (HMM E-Value=7.8e-10) 28 8.1 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 28 8.1 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 232 bits (567), Expect = 2e-61 Identities = 108/151 (71%), Positives = 128/151 (84%) Frame = +2 Query: 107 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDHLDNNPALEKL 286 Q LDEYPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ HL+NNP LEKL Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLEKL 60 Query: 287 LPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFF 466 LPHIKGN+GFVFT+ DL +VR ++ENKV APA+ G IAP+ V +PA NTGLGPEKTSFF Sbjct: 61 LPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFF 120 Query: 467 QALSIPTKISKGTIEIINDVHILKPGDKVGA 559 QAL+IPTKI++GTIEIINDVH++K +K+ A Sbjct: 121 QALAIPTKIARGTIEIINDVHLIKKDEKLKA 151 >SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 35.1 bits (77), Expect = 0.054 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +2 Query: 221 KNTMMRKAIKDHLDNNPALEKLLPHIKGNVGFVFTRGDL 337 K T++RK +K HLDN P L K LP + G + + + GDL Sbjct: 168 KVTIVRKELKSHLDNLPDLSK-LPDVDGGLAPLPSAGDL 205 >SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) Length = 870 Score = 32.3 bits (70), Expect = 0.38 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = -2 Query: 523 IVDDFNSTL*NFGRDGKSLEERGFLWTEAGVVGGNDD*QWG 401 I+D NS + R K+LEERG L+ +GV GG + ++G Sbjct: 144 IIDGGNSEYKDSMRRCKALEERGLLFVGSGVSGGEEGARYG 184 >SB_58702| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.059) Length = 765 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +3 Query: 321 SPAETSLRSVTNCWRTKSRLQLVPVPLPHCQSSFPPTTPASVQRKPLSSKLFPSLPKFQR 500 S + TS ++ WR K L + L SS P +TPAS+ ++ L PSL Q Sbjct: 561 SLSPTSESAMLQNWRQKLERPLTTLKLNQPDSS-PASTPASIPESANNTPLHPSLSSKQE 619 Query: 501 VLLKSS 518 + S Sbjct: 620 TNVPKS 625 >SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) Length = 2053 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 555 PTLSPGFKMCTSLMISIVPFEILVGMERAWKKEVFSGPR 439 P P F+ C +L+ ++ ++ M RAW+KEV S R Sbjct: 1843 PRNVPNFRACCALVSALSGYQY---MRRAWRKEVISSQR 1878 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +2 Query: 362 ENKVQAPARPGAIAPLSVVIPAHN--TGLGPEKTSFFQALSIPTKISKGTIEIINDVHIL 535 E ++ +PA +P S+ TGL P S Q LS+ T + ++ D+ Sbjct: 2069 EPRIVSPAGSSLASPTSIATSVITGVTGLHPVTVSHHQPLSVITSLVSASVSSTTDMQNS 2128 Query: 536 KPGDK 550 PG K Sbjct: 2129 TPGKK 2133 >SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1332 Score = 29.5 bits (63), Expect = 2.7 Identities = 20/81 (24%), Positives = 36/81 (44%) Frame = +3 Query: 237 AKPSKTTWTTIQPSRNCCHTSRATLASCSPAETSLRSVTNCWRTKSRLQLVPVPLPHCQS 416 +K +TWT + +RN T ++ L +P L N + Q +PV + +C++ Sbjct: 92 SKARSSTWTRTRNARNLIDTQQSQLEMNNPQH--LHRTYNFSMMNNVRQPIPVLVNNCRA 149 Query: 417 SFPPTTPASVQRKPLSSKLFP 479 + S ++ SS L P Sbjct: 150 NDKLVESQSKRKSARSSNLIP 170 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 429 WAGMTTDNGAMAPGRAGAWTLFSNSL 352 W+ T D PGRA AW+L+S +L Sbjct: 594 WSIATLDGKDQPPGRAWAWSLWSTTL 619 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 121 VPKMFHRGCR*RGLATDAADPYLAT-WLQYRAHGKKHYDA 237 VPKMFH RG+ T+A P + T +L+ R G++ +A Sbjct: 3856 VPKMFHGNRDNRGIKTNAIFPTIITRYLRIRPMGRRGLNA 3895 >SB_47997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 348 VTNCWRTKSRLQLVPVPLPHCQSSFPPTTPASV 446 V +C R PVP PH ++S PT P SV Sbjct: 2 VVSCPRLFLDPMPAPVPRPHARASASPTHPTSV 34 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -3 Query: 366 FSNSLSRTSTRSPRVNTKPTLPLMCGNSFSRAGLLSR 256 FS+S + T KP +CG SFS++G LSR Sbjct: 464 FSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSR 500 >SB_671| Best HMM Match : Pneumo_matrix (HMM E-Value=3.9) Length = 907 Score = 28.3 bits (60), Expect = 6.2 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 9/118 (7%) Frame = +3 Query: 255 TWTTIQPSRNCCHTSRATLASCSPAETSLRSVTNCWRTKSRLQLVPV------PLPHCQS 416 T TT P + H + + C + VTN + + ++V V P S Sbjct: 338 TTTTSHPLHHV-HATIKCESPCYELQKVTFDVTNPFTSGGEFRVVLVEAQSAFPGSGSSS 396 Query: 417 SFPPTTPASVQRKPLSSKL---FPSLPKFQRVLLKSSTMYTS*SPVTRLELLKPPFST 581 + P PA +KP+ ++ PS P +RVL+ SS ++ ++ +E+ PFST Sbjct: 397 TTPRNKPAKPAKKPVVARTDHGCPS-PSAKRVLVSSSFVHLDGKSLSTIEVHFLPFST 453 >SB_48995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 360 WRTKSRLQLVPVPLPHCQSSFPPT--TPASVQRKPLSSKLFPS 482 +RT+SR+ L LP+ + PP+ TP + PLS PS Sbjct: 68 YRTRSRILLPITDLPYLGLNEPPSIATPCLIPNYPLSRLFSPS 110 >SB_19577| Best HMM Match : SERTA (HMM E-Value=7.8e-10) Length = 543 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/50 (40%), Positives = 23/50 (46%) Frame = -3 Query: 564 SEAPTLSPGFKMCTSLMISIVPFEILVGMERAWKKEVFSGPRPVLWAGMT 415 S P L P S I+P EILVG+ER +K V G L MT Sbjct: 258 SNGPPLEPKVWDLESAEWPIIPGEILVGLER--RKPVLKGLLITLCENMT 305 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 27.9 bits (59), Expect = 8.1 Identities = 22/106 (20%), Positives = 41/106 (38%), Gaps = 5/106 (4%) Frame = +3 Query: 138 SWVPITWARNRCSRSVSRYVAPVSCSWEKTL*C-AKPSKTTWTTIQPSRNCCHTSRATLA 314 S VP+T + + + P + + + T KP + + CC+ +A A Sbjct: 580 SSVPLTQFQAQLQQQQPAQATPTNAATQDTDSAPCKPICLKFCVTLCPQKCCNKGKAAAA 639 Query: 315 SCSPAETSLRSVTNCWRTKSRLQLVPVPLPHCQSSFP----PTTPA 440 + +P + + T T++ + P P C P P+ PA Sbjct: 640 AAAPTKPPTAAPTTAAATQAAPAAMTCPQPACAPQSPMSCMPSCPA 685 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,544,169 Number of Sequences: 59808 Number of extensions: 568120 Number of successful extensions: 1645 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1639 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -