Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0811
         (720 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g30520.1 68414.m03734 acyl-activating enzyme 14 (AAE14) ident...    29   3.1  

>At1g30520.1 68414.m03734 acyl-activating enzyme 14 (AAE14)
           identical to acyl-activating enzyme 14 [Arabidopsis
           thaliana]; similar to SP|Q42524 4-coumarate--CoA ligase
           1 (EC 6.2.1.12) (4-coumaroyl-CoA synthase 1)
           {Arabidopsis thaliana}; contains Pfam profile PF00501:
           AMP-binding enzyme; identical to cDNA acyl-activating
           enzyme 14 (At1g30520) GI:29893263
          Length = 560

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +1

Query: 457 RTGRYHHPAYFCREA-VMRFGLKGGAAVVTILETSELISQDGWRIYVVDVYGLQ*PLNTR 633
           RTGR          A ++R GL+ G  V      S+L  +  W + V  V G+  PLN R
Sbjct: 33  RTGREFVDGVLSLAAGLIRLGLRNGDVVSIAAFNSDLFLE--WLLAVALVGGVVAPLNYR 90

Query: 634 WAV 642
           W++
Sbjct: 91  WSL 93


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,271,440
Number of Sequences: 28952
Number of extensions: 324007
Number of successful extensions: 532
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 440
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 532
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)