BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0810 (312 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 0.75 AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 20 6.9 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 20 6.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 19 9.2 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 19 9.2 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 23.0 bits (47), Expect = 0.75 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +2 Query: 8 RNSFVIKKPINMPNYSYTPTIGRTYVYDNKYYKNLGCLIKNAKRKKHLV 154 +N ++ PNY TY+ NKY L+K++K K L+ Sbjct: 5 KNKLLLLDSSTQPNYLILSNKNNTYLVLNKY-----LLVKHSKPKMPLL 48 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 19.8 bits (39), Expect = 6.9 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +2 Query: 194 QLHGLPKIP 220 Q HGLP++P Sbjct: 53 QQHGLPEVP 61 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 19.8 bits (39), Expect = 6.9 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +2 Query: 194 QLHGLPKIP 220 Q HGLP++P Sbjct: 53 QQHGLPEVP 61 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 19.4 bits (38), Expect = 9.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 177 NGDLLDNYMGCR 212 NGD+L Y+G R Sbjct: 1025 NGDILGYYVGYR 1036 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 19.4 bits (38), Expect = 9.2 Identities = 7/28 (25%), Positives = 13/28 (46%) Frame = -2 Query: 92 CRTRKYARWWGCMNNSAYL*VFLLQNCY 9 CR W+ ++ + Y + Q+CY Sbjct: 57 CRYTFLLEWYHTLSKACYDCPYNTQDCY 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,402 Number of Sequences: 336 Number of extensions: 1668 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5730534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -