SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0810
         (312 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    23   0.75 
AJ888865-1|CAI61930.1|  108|Tribolium castaneum modulator of act...    20   6.9  
AJ622939-1|CAF22091.1|  108|Tribolium castaneum ETS activity mod...    20   6.9  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    19   9.2  
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     19   9.2  

>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 23.0 bits (47), Expect = 0.75
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +2

Query: 8   RNSFVIKKPINMPNYSYTPTIGRTYVYDNKYYKNLGCLIKNAKRKKHLV 154
           +N  ++      PNY        TY+  NKY      L+K++K K  L+
Sbjct: 5   KNKLLLLDSSTQPNYLILSNKNNTYLVLNKY-----LLVKHSKPKMPLL 48


>AJ888865-1|CAI61930.1|  108|Tribolium castaneum modulator of
           activity of ets genes protein.
          Length = 108

 Score = 19.8 bits (39), Expect = 6.9
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 194 QLHGLPKIP 220
           Q HGLP++P
Sbjct: 53  QQHGLPEVP 61


>AJ622939-1|CAF22091.1|  108|Tribolium castaneum ETS activity
           modulator protein.
          Length = 108

 Score = 19.8 bits (39), Expect = 6.9
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 194 QLHGLPKIP 220
           Q HGLP++P
Sbjct: 53  QQHGLPEVP 61


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 19.4 bits (38), Expect = 9.2
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 177  NGDLLDNYMGCR 212
            NGD+L  Y+G R
Sbjct: 1025 NGDILGYYVGYR 1036


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 19.4 bits (38), Expect = 9.2
 Identities = 7/28 (25%), Positives = 13/28 (46%)
 Frame = -2

Query: 92  CRTRKYARWWGCMNNSAYL*VFLLQNCY 9
           CR      W+  ++ + Y   +  Q+CY
Sbjct: 57  CRYTFLLEWYHTLSKACYDCPYNTQDCY 84


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,402
Number of Sequences: 336
Number of extensions: 1668
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 49
effective length of database: 106,121
effective search space used:  5730534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -