BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0802 (735 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41582| Best HMM Match : TYA (HMM E-Value=5.7) 30 2.2 SB_22974| Best HMM Match : TYA (HMM E-Value=5.7) 30 2.2 SB_12939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 >SB_41582| Best HMM Match : TYA (HMM E-Value=5.7) Length = 253 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -1 Query: 492 NTFVWQPIVSIHEHNSN---YTTVETIKNSELVSNRL 391 N F WQPI ++ H N + +ET+ + ELV +L Sbjct: 167 NFFGWQPIFNVESHIKNALGFLKLETVTDVELVMQKL 203 >SB_22974| Best HMM Match : TYA (HMM E-Value=5.7) Length = 225 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -1 Query: 492 NTFVWQPIVSIHEHNSN---YTTVETIKNSELVSNRL 391 N F WQPI ++ H N + +ET+ + ELV +L Sbjct: 167 NFFGWQPIFNVESHIKNALGFLKLETVTDVELVMQKL 203 >SB_12939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/63 (25%), Positives = 28/63 (44%) Frame = +3 Query: 69 RLQGGTLSGQREESLQDALVLIILIFFYETNSSIFCTCYRLVRSLICMFRIHDGLTQCLH 248 R GTL +R++S+ + +L Y T ++ Y L ++ C RI+ L Sbjct: 36 RTSTGTLKQRRKKSILTVMHRELLRHLYNTTRGVWVRDYTLYSTIFCYKRIYQSHVILLD 95 Query: 249 VHF 257 + F Sbjct: 96 IFF 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,747,020 Number of Sequences: 59808 Number of extensions: 460895 Number of successful extensions: 1148 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1148 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -