BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0798 (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 27 0.11 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.3 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 9.4 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 9.4 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 9.4 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 9.4 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 27.5 bits (58), Expect = 0.11 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 180 VCLTFSSLVYSTIKLASESCSCKNSDV 260 +CL +++ VYS +++ E+C SD+ Sbjct: 7 LCLVYATCVYSVSEISEETCETLMSDI 33 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.0 bits (47), Expect = 2.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 243 CKNSDVCTYVYRGVNC 290 C+N VCT ++ G C Sbjct: 347 CQNGGVCTTIHAGHKC 362 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 322 RFESRKENQNKQFTPRYTYVHT 257 R + +KE NK TPR + T Sbjct: 140 RMKHKKEQMNKVSTPRSSPAET 161 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = +1 Query: 367 FSNLLLFVNYSP 402 FS +LLF++Y+P Sbjct: 148 FSEVLLFLDYNP 159 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 263 YVRISWCKLFVLILFPGFKTKFI*NLKSFCLHI 361 Y + ++F L+ F ++KF + FCL+I Sbjct: 291 YNTVEESRIFGLVTFTPDRSKFRPSSLRFCLNI 323 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 322 RFESRKENQNKQFTPRYTYVHT 257 R + +KE NK TPR + T Sbjct: 131 RMKHKKEQMNKVSTPRSSPAET 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,657 Number of Sequences: 336 Number of extensions: 2904 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -