BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0797 (556 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30970.1 68415.m03777 aspartate aminotransferase, mitochondri... 30 1.2 >At2g30970.1 68415.m03777 aspartate aminotransferase, mitochondrial / transaminase A (ASP1) identical to SP|P46643 Aspartate aminotransferase, mitochondrial precursor (EC 2.6.1.1) (Transaminase A) {Arabidopsis thaliana} Length = 430 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -1 Query: 334 YLRIP---NHINIYKNTFYIQNLYHYYRLET 251 Y+ +P NH NI+K+ Q YHYY ET Sbjct: 154 YIPVPTWSNHHNIWKDAQVPQKTYHYYHPET 184 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,237,467 Number of Sequences: 28952 Number of extensions: 175105 Number of successful extensions: 216 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 216 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -