BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0790 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6306| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-05) 32 0.46 SB_57199| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 9.9 >SB_6306| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-05) Length = 471 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 649 MSLIPIHHLQNYLYRNSDT*VIYTKRIVCMYFA--STLTTL 765 M + I +L NYL N+ T +Y RIV Y A STL TL Sbjct: 180 MQCLTIMNLDNYLVCNTSTYAVYLSRIVIHYAASFSTLATL 220 >SB_57199| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 374 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 99 FAVMSLICCYY*LNENTNYLFKAN-RSNFKSLWDKLFIYMP*R 224 FA L Y LN +LF N R+ FK+LW+ L P R Sbjct: 289 FAAFFLGYAYSVLNPCVYFLFNKNYRAGFKALWESLCCRWPQR 331 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,261,072 Number of Sequences: 59808 Number of extensions: 396124 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -