BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0782 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 252 1e-67 SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) 246 1e-65 SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) 200 5e-52 SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) 166 8e-42 SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) 97 1e-20 SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) 84 6e-17 SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 81 5e-16 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 80 1e-15 SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) 76 2e-14 SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 3e-11 SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) 52 2e-07 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) 39 0.002 SB_24028| Best HMM Match : DNA_photolyase (HMM E-Value=1.3e-39) 35 0.046 SB_24760| Best HMM Match : PT (HMM E-Value=0.17) 34 0.080 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 32 0.32 SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) 30 0.98 SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) 30 1.3 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_3760| Best HMM Match : SVA (HMM E-Value=0.19) 29 2.3 SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) 28 4.0 SB_19447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_15696| Best HMM Match : DUF282 (HMM E-Value=2.5) 28 5.3 SB_55431| Best HMM Match : DnaJ_C (HMM E-Value=7.2e-13) 27 6.9 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 27 6.9 SB_43146| Best HMM Match : Ank (HMM E-Value=0) 27 6.9 SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_43957| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.6e-13) 27 9.2 SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 27 9.2 SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) 27 9.2 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 27 9.2 SB_51196| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_18788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_12627| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_1649| Best HMM Match : ANF_receptor (HMM E-Value=1.2e-05) 27 9.2 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 252 bits (617), Expect = 1e-67 Identities = 112/150 (74%), Positives = 126/150 (84%) Frame = +2 Query: 65 PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQ 244 PRVFFD+T+ + G+IV+ELRSDV P T ENFR LCT EKGFGYKGS FHR+IP FM Q Sbjct: 137 PRVFFDITIGERSAGRIVMELRSDVVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQ 196 Query: 245 GGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLD 424 GGDFT HNGTGGKSIYG KFEDENF LKHTG GVLSMAN+G +TNGSQFF+TT KT WLD Sbjct: 197 GGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGVLSMANSGPNTNGSQFFLTTEKTDWLD 256 Query: 425 GTHVVFGNVVEGMEVVKQIETFGSQSGKTS 514 G HVVFGNV+EG +VV+++E GSQSGK S Sbjct: 257 GKHVVFGNVIEGFDVVRKMEAVGSQSGKAS 286 >SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 246 bits (601), Expect = 1e-65 Identities = 111/147 (75%), Positives = 123/147 (83%) Frame = +2 Query: 74 FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGD 253 +FD+ + AP G+IV+ELR DV PKT ENFRALCTGEKGFGYKGS FHRVIP FM QGGD Sbjct: 6 YFDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGEKGFGYKGSSFHRVIPGFMCQGGD 65 Query: 254 FTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGTH 433 FT +GTGGKSIYG KF DENF LKHTGPG+LSMANAG TNGSQFF+ T KTSWLDG H Sbjct: 66 FTRGDGTGGKSIYGAKFADENFNLKHTGPGILSMANAGPGTNGSQFFLCTAKTSWLDGKH 125 Query: 434 VVFGNVVEGMEVVKQIETFGSQSGKTS 514 VVFG+V +GM+VVK+IE GS SGKTS Sbjct: 126 VVFGSVKDGMDVVKKIEKVGSDSGKTS 152 >SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 200 bits (488), Expect = 5e-52 Identities = 89/139 (64%), Positives = 109/139 (78%) Frame = +2 Query: 68 RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQG 247 +V+ DV++ P G++++ L D PKT NF AL E+GFGYK SIFHRVI NFM+QG Sbjct: 27 KVWMDVSIGGQPAGRVILGLFGDTAPKTVANFVALADKEQGFGYKDSIFHRVIKNFMIQG 86 Query: 248 GDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDG 427 GDFTN +GTGG SIYG F+DENF LKH GPG L MANAG +TNGSQF+ITT+KTSWLDG Sbjct: 87 GDFTNKDGTGGYSIYGKYFDDENFNLKHYGPGWLCMANAGKNTNGSQFYITTIKTSWLDG 146 Query: 428 THVVFGNVVEGMEVVKQIE 484 +H FG V+EGM+VV++IE Sbjct: 147 SHTCFGKVLEGMDVVRRIE 165 >SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 166 bits (404), Expect = 8e-42 Identities = 89/152 (58%), Positives = 104/152 (68%), Gaps = 18/152 (11%) Frame = +2 Query: 68 RVFFDVTVDDAPLGKI------VIELRSDVTPKTCE-----NFRAL-----CT--GEKGF 193 +VFFD+T+ G+I +I+ + + E NFR CT +KGF Sbjct: 28 KVFFDITIGGEKAGRIEIGLFVIIKTYYLLATRLVESLIGTNFRYFDTYYCCTIESQKGF 87 Query: 194 GYKGSIFHRVIPNFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGAD 373 GYK SIFHRVI +FM+QGGDFT +GTGGKSIYG KF DENF L+H G G LSMANAG D Sbjct: 88 GYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKD 147 Query: 374 TNGSQFFITTVKTSWLDGTHVVFGNVVEGMEV 469 TNGSQFFITTVKT WLDG HVVFG V++GMEV Sbjct: 148 TNGSQFFITTVKTPWLDGRHVVFGKVLKGMEV 179 >SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) Length = 99 Score = 96.7 bits (230), Expect = 1e-20 Identities = 45/73 (61%), Positives = 56/73 (76%), Gaps = 1/73 (1%) Frame = +2 Query: 266 NGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGTHVVF 442 +GTGG+SI+G +FEDE + L+H P +SMANAG +TNGSQFFIT V T WLD H VF Sbjct: 2 DGTGGESIWGGEFEDEFHRNLRHDRPYTVSMANAGPNTNGSQFFITVVPTPWLDNKHTVF 61 Query: 443 GNVVEGMEVVKQI 481 G VV+GM+V +QI Sbjct: 62 GRVVKGMDVAQQI 74 >SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) Length = 145 Score = 84.2 bits (199), Expect = 6e-17 Identities = 36/72 (50%), Positives = 49/72 (68%) Frame = +2 Query: 269 GTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGTHVVFGN 448 G GG+S+YG FEDE+F++ H GV+ MAN G TNGSQF+IT W+D +V FG Sbjct: 46 GIGGESVYGPLFEDEDFSVAHNRRGVVGMANKGRHTNGSQFYITLQPAPWMDTKYVAFGQ 105 Query: 449 VVEGMEVVKQIE 484 V+EG+ V+ +E Sbjct: 106 VIEGLNVLDVLE 117 >SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 82.6 bits (195), Expect = 2e-16 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +2 Query: 353 MANAGADTNGSQFFITTVKTSWLDGTHVVFGNVVEGMEVVKQIE 484 MANAG DTNGSQFFITTVKTSWLDG HVVFG V+EGM+VV+++E Sbjct: 1 MANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKLE 44 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 81.0 bits (191), Expect = 5e-16 Identities = 42/74 (56%), Positives = 51/74 (68%) Frame = +2 Query: 266 NGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGTHVVFG 445 NGTGG+SIYG F DE F KH P +LSMAN G +TNGSQFFI HVVFG Sbjct: 25 NGTGGESIYGGTFGDECFEFKHERPMLLSMANRGPNTNGSQFFI----------IHVVFG 74 Query: 446 NVVEGMEVVKQIET 487 +V++G E+V+QIE+ Sbjct: 75 HVIQGEELVRQIES 88 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 79.8 bits (188), Expect = 1e-15 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = +2 Query: 326 KHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGTHVVFGNVVEGMEVVKQIE 484 +H PG+LSMAN+G +TNGSQFFITTV T LDG HVVFG V++GM+VV+++E Sbjct: 188 EHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELE 240 >SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) Length = 49 Score = 76.2 bits (179), Expect = 2e-14 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +2 Query: 344 VLSMANAGADTNGSQFFITTVKTSWLDGTHVVFGNVVEGMEVVKQI 481 +LSMANAG TNGSQFF+ T KTSWLDG HVVFG+V +GM+VVK++ Sbjct: 2 ILSMANAGPGTNGSQFFLCTAKTSWLDGKHVVFGSVKDGMDVVKKM 47 >SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 65.3 bits (152), Expect = 3e-11 Identities = 51/132 (38%), Positives = 71/132 (53%), Gaps = 6/132 (4%) Frame = +2 Query: 104 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGK 283 LG+I IEL +D P + NF A + G+ Y G+ FHRVIP FM+QGG F + + Sbjct: 32 LGEIEIELDADKAPISTANFLAYV--DSGY-YAGTQFHRVIPGFMVQGGGF---DADMQQ 85 Query: 284 SIYGNKFEDENFTLKHTGPGVLSMANAGA-DTNGSQFFITTVKTSWLD-GT----HVVFG 445 ++E H G L+MA D+ SQFFI ++LD G+ + VFG Sbjct: 86 KDTQAPIKNEADNGLHNVRGTLAMARTQVRDSATSQFFINHKDNAFLDHGSRDFGYAVFG 145 Query: 446 NVVEGMEVVKQI 481 VV+GM+VV +I Sbjct: 146 KVVKGMDVVDKI 157 >SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) Length = 48 Score = 52.4 bits (120), Expect = 2e-07 Identities = 26/46 (56%), Positives = 30/46 (65%), Gaps = 8/46 (17%) Frame = +2 Query: 107 GKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 220 G+++ EL +D PKT ENFRALCTGEKG G YKG FHR Sbjct: 2 GRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHR 47 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/39 (48%), Positives = 24/39 (61%) Frame = +2 Query: 329 HTGPGVLSMANAGADTNGSQFFITTVKTSWLDGTHVVFG 445 H G +SMAN G ++NGSQFFI K LD + +FG Sbjct: 301 HNARGTVSMANNGPNSNGSQFFICYGKQPHLDMKYTMFG 339 >SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) Length = 454 Score = 39.1 bits (87), Expect = 0.002 Identities = 26/65 (40%), Positives = 35/65 (53%) Frame = +2 Query: 104 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGK 283 +G I IEL TPK C NF LC +G+ Y +IFHR++ +GG+ N G G Sbjct: 12 VGDIDIELWGKETPKACRNFIQLCL--EGY-YDNTIFHRIV-----KGGE--NIYGQSGF 61 Query: 284 SIYGN 298 + GN Sbjct: 62 KVTGN 66 >SB_24028| Best HMM Match : DNA_photolyase (HMM E-Value=1.3e-39) Length = 432 Score = 34.7 bits (76), Expect = 0.046 Identities = 26/104 (25%), Positives = 46/104 (44%) Frame = +3 Query: 3 ALSLWWFCKLLTLLIPAKCLYHEYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCALA 182 ALS C+L L C S +L T E LS V+ + + T+V C L Sbjct: 326 ALSTTVSCQLKALSTTVSC-----QSKALSTTVSCELKALSTTVSCELKALSTTVSCQLK 380 Query: 183 RKASVTRAPFSIVSSPISCCKEGTSPTITALGESPSTAISLKTR 314 ++ +S+ +SC + S T++ ++ ST +S +++ Sbjct: 381 ALSTTVSCELKALSTTVSCQSKALSTTVSCQSKALSTTVSCQSK 424 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/79 (22%), Positives = 38/79 (48%) Frame = +3 Query: 78 STSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCALARKASVTRAPFSIVSSPISCCKEGTS 257 S +L T + LS V+ + + T+V C L ++ +S+ +SC + S Sbjct: 324 SKALSTTVSCQLKALSTTVSCQSKALSTTVSCELKALSTTVSCELKALSTTVSCQLKALS 383 Query: 258 PTITALGESPSTAISLKTR 314 T++ ++ ST +S +++ Sbjct: 384 TTVSCELKALSTTVSCQSK 402 >SB_24760| Best HMM Match : PT (HMM E-Value=0.17) Length = 422 Score = 33.9 bits (74), Expect = 0.080 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = -1 Query: 474 FTTSMPSTTFPKTTCVPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 334 FTT PST P T PS+ E +T WEP P PGP Sbjct: 33 FTTGEPSTWEPMTGA-PSTWEPMTGAPSTWEPWTDGPGPYPTDGPGP 78 Score = 31.5 bits (68), Expect = 0.43 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -1 Query: 444 PKTTCVPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 334 P TT PS+ E +T WEP+ AP+ T GP Sbjct: 32 PFTTGEPSTWEPMTGAPSTWEPMTGAPSTWEPWTDGP 68 >SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) Length = 175 Score = 31.9 bits (69), Expect = 0.32 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +2 Query: 431 HVVFGNVVEGMEVVKQIET 487 HVVFG+V++G E+V+QIE+ Sbjct: 3 HVVFGHVIQGEELVRQIES 21 >SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.7 bits (66), Expect = 0.74 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 456 STTFPKTTCVPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 334 + FP TT P + + T + EPL+ P +R P P Sbjct: 19 TAAFPTTTTTPVTTQTTTTDVSRTEPLIELPTAQEKRKPCP 59 >SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) Length = 885 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +2 Query: 98 APLGKIVIELRSDVTPKTCENFRALCTG 181 AP I+I L S V+PKT E+ R LC G Sbjct: 569 APKIDIIIALDSGVSPKTFEDERQLCAG 596 >SB_32934| Best HMM Match : K_tetra (HMM E-Value=7.79963e-42) Length = 1207 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -3 Query: 139 DVTSQL-NNNFSQWGIVNSDVEEYSW*RHFAGISNVSNLQNHHNDNA 2 DV S L S WGI + D+E+ W + I+ L++ H D+A Sbjct: 90 DVCSTLFQEELSYWGINDRDMEQCCWAHYKRQINTEETLKSFHLDSA 136 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -1 Query: 492 PKVSICFTTSMPSTTFPKTTCVPSSQEVLTVVMKNWEPLVSAPALAMERTPGPVCLRVKF 313 P+ TTS PST+ P+T ++ T N AP+ + RT + LR Sbjct: 87 PRTGSTTTTSAPSTSTPRTGSTTTTSAPSTSTTSN--STTRAPSTSTPRTGSTITLRTST 144 Query: 312 SS 307 +S Sbjct: 145 TS 146 >SB_3760| Best HMM Match : SVA (HMM E-Value=0.19) Length = 259 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = -1 Query: 447 FPKTTCVPSSQE-----VLTVVMKNWEPLVSAPALAMERTPGP 334 FP+ + +P S E +LT++++N P ++APA + P P Sbjct: 81 FPQPSLLPPSSESFDITLLTILLRNICPTLTAPATGWDALPAP 123 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -1 Query: 177 VHRARKFSHVLGV--TSLLSSITIFPSGASSTVTSKNTRGRDILPV 46 + + KF+H+ G+ TS T+F +T T TR RD++ + Sbjct: 168 IQQLHKFTHIHGMLSTSSRGRYTLFRGQYDTTATQIYTRSRDVIDI 213 >SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) Length = 674 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 183 RKASVTRAPFSIVSSPISCCKEGTSPTITALGESP 287 +K R S V SC +EG SPT T+ G++P Sbjct: 276 KKPFSNREAHSCVELCRSCVREGCSPTPTSRGDAP 310 >SB_19447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1110 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = -1 Query: 447 FPKTTCVPSSQE-----VLTVVMKNWEPLVSAPALAMERTPGP 334 FP+ +P S E +LT++++N P ++APA + P P Sbjct: 81 FPQPPLLPPSSESFDITLLTILLRNICPTLTAPATGWDALPAP 123 >SB_15696| Best HMM Match : DUF282 (HMM E-Value=2.5) Length = 128 Score = 27.9 bits (59), Expect = 5.3 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 168 PCALARKASVTRAPFSIVSSPISCCKE-GTSPTITA-LGESPST 293 PCALA SV+ P S VSS + G S TI+A SP T Sbjct: 48 PCALATAPSVSEVPASTVSSSSPLRRSPGPSGTISASTSGSPRT 91 >SB_55431| Best HMM Match : DnaJ_C (HMM E-Value=7.2e-13) Length = 278 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 158 NFRALCTGEKGFGYKGSIF 214 NF + TG+KGFG++G F Sbjct: 67 NFSSYSTGQKGFGFEGMDF 85 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 158 NFRALCTGEKGFGYKGSIF 214 NF + TG+KGFG++G F Sbjct: 132 NFSSYSTGQKGFGFEGMDF 150 >SB_43146| Best HMM Match : Ank (HMM E-Value=0) Length = 282 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -1 Query: 222 TRWKMEPL*PKPFSPVHRARKFSHVLGVTSLL 127 TR+ +EP K F+P+H A ++ HV V LL Sbjct: 3 TRYPIEPA--KGFTPLHEAARYGHVHIVKLLL 32 >SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4482 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +3 Query: 213 SIVSSPISCCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPWLMPVLILM 380 SIVS+ IS C T P+ T S+ + K I L D ++ P LIL+ Sbjct: 1087 SIVSNRISFCFNFTGPSFTVDTACSSSLTAFKLAIDNLQNGDCEAAIVCAPNLILI 1142 >SB_43957| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.6e-13) Length = 560 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/52 (23%), Positives = 20/52 (38%) Frame = -3 Query: 220 TMENGALVTEAFLASAQGTEVFTRLGSDVTSQLNNNFSQWGIVNSDVEEYSW 65 T + L F S RLG + ++L F W +++ E +W Sbjct: 95 TKDKAVLKALHFYDSCMDKAEIERLGGEPLTKLIKEFGSWAVIDKSWNETNW 146 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 132 VTSLPRRVKTSVPCALARKASVTRAPFSIVSSPIS 236 VT LP VK + + ASVT P S+ P+S Sbjct: 1224 VTQLPVSVKHLLTSVMHLHASVTHLPASVTQLPVS 1258 >SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) Length = 1776 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -1 Query: 471 TTSMPSTTFPKTTCVPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 334 TT+ P TT P+TT P + T + P+ + P T P Sbjct: 162 TTTTPETTAPRTT-TPETTTPETTTPRTTTPVTTTPRTTTPETTTP 206 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = -1 Query: 492 PKVSICFTTSMPSTTFPKTTCVPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 334 P + TT+ P TT P+TT P + T + P + P +T P Sbjct: 1771 PPTTTTTTTTTPETTAPRTT-TPETTTPETTTPRTTTPETTKPRTTTPKTTTP 1822 >SB_51196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 365 GADTNGSQFFITTVKTSWLDGTHVVF 442 G D NG+ IT V+++W THV F Sbjct: 237 GTDENGTFRKITQVQSTWRASTHVRF 262 >SB_18788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 820 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = -1 Query: 186 FSPVHRARKFSHVLGVTSLLSSITIFPSGASSTVTSKNTRGRDILPVLAM*AIYKTTTMT 7 FSPV+ A F+ L V LL P+GA T G+ + V M + T+ Sbjct: 16 FSPVNLAPTFNGRLQVAILLKGSRHAPTGAVQVPTQPENGGKVSIHVSVMTYAWSLETVA 75 Query: 6 M 4 M Sbjct: 76 M 76 >SB_12627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 198 TRAPFSIVSSPISCCKEGTSPTITALGESPSTAISLKTRISPLSTL 335 + A S+ S SC E S + G IS+K+++SPL+ + Sbjct: 360 SEASVSLTESVSSCSYESGSHLSASPGREEMGEISVKSKVSPLANV 405 >SB_1649| Best HMM Match : ANF_receptor (HMM E-Value=1.2e-05) Length = 481 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -1 Query: 186 FSPVHRARKFSHVLGVTSLLSSITIFPSGASSTVTSKNTRGRDILPVL 43 +SPVH K + + V + I + + +S+ RG ++L V+ Sbjct: 321 YSPVHNVEKSKNAITVLDTMKKIKVVGTTGQIHFSSEGERGGEMLDVM 368 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,714,355 Number of Sequences: 59808 Number of extensions: 446685 Number of successful extensions: 1512 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1504 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -