BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0779 (335 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23100.1 68415.m02756 DC1 domain-containing protein contains ... 30 0.44 At3g57830.1 68416.m06447 leucine-rich repeat transmembrane prote... 27 4.1 >At2g23100.1 68415.m02756 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 711 Score = 29.9 bits (64), Expect = 0.44 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 242 SVPAAHPSYVCYVTLPGGACFGSFQNCPTK 331 SV +HP++ Y+ L GAC G C K Sbjct: 524 SVHESHPNHPIYINLTKGACMGCSNACSRK 553 >At3g57830.1 68416.m06447 leucine-rich repeat transmembrane protein kinase, putative several receptor-like protein kinases Length = 662 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 83 PSGTAPGTPWPRRYLIAARGACG 15 PS T P WP R LIA A G Sbjct: 449 PSNTLPSLSWPERLLIAQGTARG 471 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,801,360 Number of Sequences: 28952 Number of extensions: 80832 Number of successful extensions: 262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 389454624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -