BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1204 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 116 2e-26 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 1e-18 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 82 4e-16 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 82 4e-16 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 5e-15 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 9e-14 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 74 1e-13 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 68 6e-12 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 60 1e-09 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 60 2e-09 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 60 2e-09 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 59 4e-09 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 58 5e-09 SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 57 1e-08 SB_35366| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-08 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 56 2e-08 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 56 2e-08 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 56 3e-08 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 56 3e-08 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_29747| Best HMM Match : Ank (HMM E-Value=0) 56 3e-08 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 55 6e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 55 6e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 55 6e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 55 6e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 55 6e-08 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 55 6e-08 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 55 6e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 55 6e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 55 6e-08 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 55 6e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 55 6e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 55 6e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 55 6e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 55 6e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 55 6e-08 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 55 6e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 55 6e-08 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 55 6e-08 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 55 6e-08 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 55 6e-08 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 55 6e-08 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 55 6e-08 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 55 6e-08 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 55 6e-08 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 55 6e-08 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 55 6e-08 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 55 6e-08 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 55 6e-08 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 55 6e-08 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 55 6e-08 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 55 6e-08 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 55 6e-08 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 55 6e-08 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 55 6e-08 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 55 6e-08 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 55 6e-08 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 55 6e-08 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 55 6e-08 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 55 6e-08 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 55 6e-08 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 55 6e-08 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 55 6e-08 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 55 6e-08 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 55 6e-08 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 55 6e-08 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 55 6e-08 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 55 6e-08 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 55 6e-08 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 55 6e-08 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 55 6e-08 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 55 6e-08 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 55 6e-08 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 55 6e-08 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 55 6e-08 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 55 6e-08 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 55 6e-08 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 55 6e-08 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 55 6e-08 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 55 6e-08 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 55 6e-08 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 55 6e-08 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 55 6e-08 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 55 6e-08 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 55 6e-08 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 55 6e-08 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 55 6e-08 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 55 6e-08 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 116 bits (279), Expect = 2e-26 Identities = 55/82 (67%), Positives = 69/82 (84%) Frame = +3 Query: 9 STKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 188 S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 189 MPKLKAFQKIQIRLVRELEKKF 254 +P+++AFQKIQ RLVRELEKKF Sbjct: 68 VPQIRAFQKIQTRLVRELEKKF 89 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = +2 Query: 245 KEVRGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 349 K+ GKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 87 KKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 90.2 bits (214), Expect = 1e-18 Identities = 43/63 (68%), Positives = 47/63 (74%) Frame = -2 Query: 588 AIQAAQTVGKGRSGAGPLRYYASWRKGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYR 409 AIQAAQ +G+ GAG + +GMCCKAIKLGNA VFP VVKRRPVNCNTTHYR Sbjct: 6 AIQAAQLLGRA-IGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYR 64 Query: 408 ANW 400 ANW Sbjct: 65 ANW 67 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 87.0 bits (206), Expect = 1e-17 Identities = 42/62 (67%), Positives = 45/62 (72%) Frame = +1 Query: 403 IRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSL 582 IRPIVSRITIHWPSFY RRDWENPGV QLNRLAAHP + ++ RT P LR L Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRP-SQQLRRL 76 Query: 583 NG 588 NG Sbjct: 77 NG 78 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 81.8 bits (193), Expect = 4e-16 Identities = 38/62 (61%), Positives = 45/62 (72%) Frame = -2 Query: 585 IQAAQTVGKGRSGAGPLRYYASWRKGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRA 406 +QAAQ +G+ GAG + +GMCCK+IKL +A VFP VVKRRPVNCNTTHYRA Sbjct: 1 MQAAQLLGRA-IGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRA 59 Query: 405 NW 400 NW Sbjct: 60 NW 61 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -2 Query: 549 GAGPLRYYASWRKGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRANW 400 GAG + +GMCCKAIKLGNA VFP VVKRRPVNCNTTHYRANW Sbjct: 4 GAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 81.4 bits (192), Expect = 6e-16 Identities = 38/57 (66%), Positives = 41/57 (71%) Frame = -2 Query: 570 TVGKGRSGAGPLRYYASWRKGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRANW 400 TVGKG G + +GMCCKAIKLGNA+ FP VVKRRPVNCNTTHYRANW Sbjct: 4 TVGKG-DRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 78.6 bits (185), Expect = 4e-15 Identities = 42/71 (59%), Positives = 47/71 (66%) Frame = +1 Query: 376 YPRGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRS 555 YPR A Y + +SRITIHWPS RRDWENPGVTQLNRLAAHP + ++ RT Sbjct: 266 YPRSMADYWMA--LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 323 Query: 556 PFPNSLRSLNG 588 P LRSLNG Sbjct: 324 P-SQQLRSLNG 333 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 78.2 bits (184), Expect = 5e-15 Identities = 40/63 (63%), Positives = 44/63 (69%) Frame = -2 Query: 588 AIQAAQTVGKGRSGAGPLRYYASWRKGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYR 409 AIQAAQ +G+ GAG + +GMCCKAIKL VFP VVKRRPVNCNTTHYR Sbjct: 1839 AIQAAQLLGRA-IGAGLFAITPAGERGMCCKAIKLVTP-VFPSHDVVKRRPVNCNTTHYR 1896 Query: 408 ANW 400 ANW Sbjct: 1897 ANW 1899 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.1 bits (174), Expect = 9e-14 Identities = 37/57 (64%), Positives = 40/57 (70%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 SRITIHWPSFYN WENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 57 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = -2 Query: 582 QAAQTVGKGRSGAGPLRYYASWRKGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRAN 403 + AQ +G+ GAG + +GMCCKAIKLGNAR FP KRRPVNCNTTHYRAN Sbjct: 39 RVAQLLGRS-IGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 70.9 bits (166), Expect = 8e-13 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 513 KGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRAN 403 +GMCCKAIKLGNA VF VVKRRPVNCNTTHYRAN Sbjct: 4 RGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 68.1 bits (159), Expect = 6e-12 Identities = 38/68 (55%), Positives = 43/68 (63%) Frame = +1 Query: 385 GGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFP 564 GGA PIRPIVSRITIHWP+FYN + TQLNRLAAHP + ++ R P Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP-S 92 Query: 565 NSLRSLNG 588 LRSLNG Sbjct: 93 QQLRSLNG 100 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.3 bits (157), Expect = 1e-11 Identities = 35/57 (61%), Positives = 39/57 (68%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 SRITIHWPSFYN +NPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 57 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 64.9 bits (151), Expect = 5e-11 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 SRITIHWPSFYN + PGVTQLNRLAAHP + +++ RT P LRSLNG Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRP-SQQLRSLNG 57 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 64.1 bits (149), Expect = 9e-11 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 SRITIHWPSFYN +N GVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 57 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 64.1 bits (149), Expect = 9e-11 Identities = 34/57 (59%), Positives = 38/57 (66%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 SRITIHWPSFYN +N GVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 57 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 63.3 bits (147), Expect = 2e-10 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -2 Query: 597 ANLAIQAAQTVGKGRSGAGPLRYYASWRKGMCCKA-IKLGNARVFPVTTVVKRRPVNCNT 421 ++L QAAQ +G+ GAG + KG + +KLG + FP VVKRRPVNCNT Sbjct: 37 SDLPSQAAQLLGRA-IGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNT 95 Query: 420 THYRANW 400 THYRANW Sbjct: 96 THYRANW 102 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 62.9 bits (146), Expect = 2e-10 Identities = 34/62 (54%), Positives = 39/62 (62%) Frame = +1 Query: 403 IRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSL 582 +RP+VSRITIHW SFYN + + L L PLSPAGVIA+ RT P LRSL Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRP-SQQLRSL 91 Query: 583 NG 588 NG Sbjct: 92 NG 93 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 60.5 bits (140), Expect = 1e-09 Identities = 33/57 (57%), Positives = 36/57 (63%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 SRITIHWPSFYN + + L L PLSPAGVIAKRP + P LRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIA-LPKQLRSLNG 57 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 60.1 bits (139), Expect = 2e-09 Identities = 38/74 (51%), Positives = 42/74 (56%), Gaps = 7/74 (9%) Frame = +1 Query: 388 GARYPIRPIVSRITIHWPSFYN-------RRDWENPGVTQLNRLAAHPLSPAGVIAKRPR 546 G YP P SR H S+YN RRDWENPGVTQLNRLAAHP + ++ R Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 98 Query: 547 TRSPFPNSLRSLNG 588 T P LRSLNG Sbjct: 99 TDRP-SQQLRSLNG 111 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 59.7 bits (138), Expect = 2e-09 Identities = 32/75 (42%), Positives = 39/75 (52%) Frame = +1 Query: 364 CVRCYPRGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRP 543 C RC+ P+ ++ RRDWENPGVTQLNRLAAHP + ++ Sbjct: 129 CARCFAGWPVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 188 Query: 544 RTRSPFPNSLRSLNG 588 RT P LRSLNG Sbjct: 189 RTDRP-SQQLRSLNG 202 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 58.8 bits (136), Expect = 4e-09 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 7/60 (11%) Frame = +1 Query: 430 IHWPSFYN-------RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 IH+ S+YN RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 1522 >SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 58.8 bits (136), Expect = 4e-09 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 14/84 (16%) Frame = +1 Query: 379 PRGGARYPIRPIVSRITIHWPS-------FYN-------RRDWENPGVTQLNRLAAHPLS 516 P+ G R PI + R W S +YN RRDWENPGVTQLNRLAAHP Sbjct: 45 PKNGQRAPINDFLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 104 Query: 517 PAGVIAKRPRTRSPFPNSLRSLNG 588 + ++ RT P LRSLNG Sbjct: 105 ASWRNSEEARTDRP-SQQLRSLNG 127 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 58.4 bits (135), Expect = 5e-09 Identities = 32/69 (46%), Positives = 38/69 (55%) Frame = +1 Query: 382 RGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPF 561 RGG P+ ++ RRDWENPGVTQLNRLAAHP + ++ RT P Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP- 101 Query: 562 PNSLRSLNG 588 LRSLNG Sbjct: 102 SQQLRSLNG 110 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 58.4 bits (135), Expect = 5e-09 Identities = 32/57 (56%), Positives = 36/57 (63%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 SRITIHWPSFYN + VTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 57 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 58.4 bits (135), Expect = 5e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 597 ANLAIQAAQTVGKGRSGAGPLRYYASWRKGMCCKAIKLGNARVFPVTT 454 A AIQAAQ +G+ GAG + +GMCCKAIKLGNARVFPVTT Sbjct: 10 APFAIQAAQLLGRA-IGAGLFAITPAGERGMCCKAIKLGNARVFPVTT 56 >SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 58.0 bits (134), Expect = 6e-09 Identities = 38/90 (42%), Positives = 47/90 (52%), Gaps = 7/90 (7%) Frame = +1 Query: 340 ATLKDIDLCVRCYPRGGARYPIRPIVSRITIHWPSFYN-------RRDWENPGVTQLNRL 498 A + +D+C C+ P + TI S+YN RRDWENPGVTQLNRL Sbjct: 26 AGIDKLDICDYCFIEVMTSPPQATPPTVRTIRPESYYNSLAVVLQRRDWENPGVTQLNRL 85 Query: 499 AAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 AAHP + ++ RT P LRSLNG Sbjct: 86 AAHPPFASWRNSEEARTDRP-SQQLRSLNG 114 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 57.2 bits (132), Expect = 1e-08 Identities = 31/69 (44%), Positives = 38/69 (55%) Frame = +1 Query: 382 RGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPF 561 +GG P+ ++ RRDWENPGVTQLNRLAAHP + ++ RT P Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP- 109 Query: 562 PNSLRSLNG 588 LRSLNG Sbjct: 110 SQQLRSLNG 118 >SB_35366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 54.8 bits (126), Expect(2) = 1e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 106 Score = 22.2 bits (45), Expect(2) = 1e-08 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +1 Query: 373 CYPRGGARYPIRPIVSRITIH 435 C P G + + ++SR+T+H Sbjct: 2 CIPEGMTKTELVDLLSRLTVH 22 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.8 bits (131), Expect = 1e-08 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = +1 Query: 445 FYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 F RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 68 FLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 114 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 56.8 bits (131), Expect = 1e-08 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 3/63 (4%) Frame = +1 Query: 409 PIVSRITIHWPSF---YNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRS 579 P++ R+ ++ S RRDWENPGVTQLNRLAAHP + ++ RT P LRS Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRS 108 Query: 580 LNG 588 LNG Sbjct: 109 LNG 111 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -3 Query: 587 PFRLRKLLGKGDRVRGLFAITPAGERGCAARRLSWVTPGFSQSRR 453 PFRLR G+G VR + + GCAARRLSWVTPGFSQSRR Sbjct: 47 PFRLRNC-GEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR 90 Score = 35.9 bits (79), Expect = 0.029 Identities = 31/70 (44%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = -1 Query: 631 IFNKIFNALQICQFSHSG--CANCWERAIGCGASSLLRQLAKGDVLQGD*VG*RQGFPSH 458 IF F+ L+ SHS NC E ASSLLRQLAKG GF Sbjct: 30 IFAIAFHRLKNQGASHSPFRLRNCGEGR-SVRASSLLRQLAKGGCAARRLSWVTPGFSQS 88 Query: 457 DGCKTTASEL 428 CKTTASEL Sbjct: 89 RRCKTTASEL 98 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 56.4 bits (130), Expect = 2e-08 Identities = 31/68 (45%), Positives = 37/68 (54%) Frame = +1 Query: 385 GGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFP 564 G +YP ++ RRDWENPGVTQLNRLAAHP + ++ RT P Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-S 75 Query: 565 NSLRSLNG 588 LRSLNG Sbjct: 76 QQLRSLNG 83 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 56.0 bits (129), Expect = 3e-08 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = +1 Query: 448 YNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 + RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 44 FTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 89 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 56.0 bits (129), Expect = 3e-08 Identities = 33/74 (44%), Positives = 40/74 (54%) Frame = +1 Query: 367 VRCYPRGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPR 546 V+ P GG P+ ++ RRDWENPGVTQLNRLAAHP + ++ R Sbjct: 1042 VKPLPSGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 1099 Query: 547 TRSPFPNSLRSLNG 588 T P LRSLNG Sbjct: 1100 TDRP-SQQLRSLNG 1112 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 56.0 bits (129), Expect = 3e-08 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +2 Query: 431 FTGRRFTTVVTGKTLALPNLIALQHIP 511 +TGRRFTT+VTGKTLALPNLIALQHIP Sbjct: 54 WTGRRFTTLVTGKTLALPNLIALQHIP 80 >SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 56.0 bits (129), Expect = 3e-08 Identities = 37/95 (38%), Positives = 51/95 (53%), Gaps = 10/95 (10%) Frame = +1 Query: 334 KEATLKDIDLCVRCYPRGGARYPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 ++A L+ +D + GG+ R + + + + S+YN RRDWENPGVT Sbjct: 28 RKALLESLDTAIEFLQPGGSTSS-RAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 86 Query: 484 QLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 QLNRLAAHP + ++ RT P LRSLNG Sbjct: 87 QLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 120 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 55.6 bits (128), Expect = 3e-08 Identities = 32/74 (43%), Positives = 40/74 (54%) Frame = +1 Query: 367 VRCYPRGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPR 546 +R Y + G P+ ++ RRDWENPGVTQLNRLAAHP + ++ R Sbjct: 52 IRRYQKSGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 109 Query: 547 TRSPFPNSLRSLNG 588 T P LRSLNG Sbjct: 110 TDRP-SQQLRSLNG 122 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + +++ RT P LRSLNG Sbjct: 129 RRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRP-SQQLRSLNG 172 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 55.6 bits (128), Expect = 3e-08 Identities = 31/68 (45%), Positives = 37/68 (54%) Frame = +1 Query: 385 GGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFP 564 G A P+ ++ RRDWENPGVTQLNRLAAHP + ++ RT P Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-S 96 Query: 565 NSLRSLNG 588 LRSLNG Sbjct: 97 QQLRSLNG 104 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 55.6 bits (128), Expect = 3e-08 Identities = 33/82 (40%), Positives = 40/82 (48%) Frame = +1 Query: 343 TLKDIDLCVRCYPRGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPA 522 T + D C R P+ ++ RRDWENPGVTQLNRLAAHP + Sbjct: 38 TCGEFDTCGEFDTRDEFGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFAS 97 Query: 523 GVIAKRPRTRSPFPNSLRSLNG 588 ++ RT P LRSLNG Sbjct: 98 WRNSEEARTDRP-SQQLRSLNG 118 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 226 RRDWENPGVTQLNRLAAHPPFASWRTSEEARTDRP-SQQLRSLNG 269 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 55.6 bits (128), Expect = 3e-08 Identities = 33/73 (45%), Positives = 39/73 (53%) Frame = +1 Query: 370 RCYPRGGARYPIRPIVSRITIHWPSFYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRT 549 RC R G P+ ++ RRDWENPGVTQLNRLAAHP + ++ RT Sbjct: 52 RCVSRIGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 109 Query: 550 RSPFPNSLRSLNG 588 P LRSLNG Sbjct: 110 DRP-SQQLRSLNG 121 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = +1 Query: 445 FYNRRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 F RRDWENPGVTQLNRLAAHP + ++ RT P +RSLNG Sbjct: 11 FLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQVRSLNG 57 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + +++ RT P LRSLNG Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRP-SQQLRSLNG 107 >SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 55.6 bits (128), Expect = 3e-08 Identities = 37/92 (40%), Positives = 49/92 (53%), Gaps = 10/92 (10%) Frame = +1 Query: 343 TLKDIDLCVRCYPRGGARYPIRPIVSRITIH---WPSFYN-------RRDWENPGVTQLN 492 T ++I C+ GG+ R + + + + S+YN RRDWENPGVTQLN Sbjct: 3 TYRNIPQCIEFLQPGGSTSS-RAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLN 61 Query: 493 RLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RLAAHP + ++ RT P LRSLNG Sbjct: 62 RLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 92 >SB_29747| Best HMM Match : Ank (HMM E-Value=0) Length = 416 Score = 55.6 bits (128), Expect = 3e-08 Identities = 37/88 (42%), Positives = 47/88 (53%), Gaps = 14/88 (15%) Frame = +1 Query: 367 VRCYPRGGARYPIRPIVSRITIHWPS-------FYN-------RRDWENPGVTQLNRLAA 504 ++C+ GG P+ ++ R W S +YN RRDWENPGVTQLNRLAA Sbjct: 256 IQCFKMGGPGDPL--VLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAA 313 Query: 505 HPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 HP + ++ RT P LRSLNG Sbjct: 314 HPPFASWRNSEEARTDRP-SQQLRSLNG 340 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + +++ RT P LRSLNG Sbjct: 137 RRDWENPGVTQLNRLAAHPPFASWGNSEKARTDRP-SQQLRSLNG 180 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + +++ RT P LRSLNG Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEQARTDRP-SQQLRSLNG 85 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWSNSEEARTDRP-SQQLRSLNG 87 >SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 17 RRDWENPGVTQLNRLAAHPPFASWRSSEEARTDRP-SQQLRSLNG 60 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 71 RRDWENPGVTQLNRLAAHPPFASWSNSEEARTDRP-SQQLRSLNG 114 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 41 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 84 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 21 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 64 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 68 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 111 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 50 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 93 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 85 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 68 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 111 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 73 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 116 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 87 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 107 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 76 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 119 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 52 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 95 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 41 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 84 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 31 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 74 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 56 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 99 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 65 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 108 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 59 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 102 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 75 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 118 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 106 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 89 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 222 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 265 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 117 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 160 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 98 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 34 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 77 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 65 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 53 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 96 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 387 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 430 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 113 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 156 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 89 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 132 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 88 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 14 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 57 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 24 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 67 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 87 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 109 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 152 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 51 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 94 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 346 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 389 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 86 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 129 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 56 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 99 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 65 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 65 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 108 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 92 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 140 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 183 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 69 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 112 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 88 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 149 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 192 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 839 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 882 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 65 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 66 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 109 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 83 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 122 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 73 RRDWENPGVTQLNRLAAHPPFASWGNSEEARTDRP-SQQLRSLNG 116 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 62 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 105 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 75 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 118 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 262 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 305 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 120 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 163 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 56 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 99 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 85 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 43 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 86 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 107 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 150 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 120 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 163 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 88 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 69 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 107 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 43 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 86 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 83 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 17 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 60 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 25 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 68 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 402 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 445 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 51 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 94 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 60 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 103 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 85 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 125 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 168 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 61 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 104 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 71 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 114 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 74 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 117 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 420 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 463 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 117 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 160 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 73 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 116 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 62 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 105 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 52 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 95 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 167 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 210 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 71 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 114 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 58 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 101 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 137 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 43 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 86 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 69 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 112 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 48 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 91 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 191 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 234 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 83 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 89 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 60 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 103 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 57 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 100 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 83 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 41 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 84 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 98 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 88 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 138 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 181 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 47 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 90 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 90 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 133 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 71 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 346 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 389 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 106 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 27 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 70 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 53 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 96 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 115 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 158 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 92 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 135 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 85 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 66 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 109 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 300 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 343 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 106 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 107 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 65 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 85 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 417 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 460 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 101 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 144 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 57 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 100 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 92 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 99 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 142 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 92 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 217 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 260 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 92 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 219 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 262 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 39 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 82 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 54 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 97 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 87 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 92 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 153 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 196 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 51 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 94 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 41 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 84 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 61 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 104 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 89 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 81 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 124 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 201 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 244 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 59 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 102 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 38 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 81 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 92 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 135 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 71 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 98 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 193 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 236 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 106 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 73 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 116 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 56 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 99 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 106 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 106 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 149 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 82 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 125 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 102 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 145 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 122 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 89 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 98 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 669 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 712 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 54 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 97 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 43 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 86 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 34 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 77 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 152 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 195 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 87 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 65 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 108 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 137 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 85 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 106 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 149 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 92 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 1196 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 1239 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -3 Query: 587 PFRLRKLLGKGDRVRGLFAITPAGERGCAARRLSW 483 PFRLR +G VR + + GCAARRLSW Sbjct: 406 PFRLRNCW-EGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 48 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 91 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 38 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 81 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 131 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 174 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 78 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 62 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 105 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 83 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 126 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 56 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 99 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 454 RRDWENPGVTQLNRLAAHPLSPAGVIAKRPRTRSPFPNSLRSLNG 588 RRDWENPGVTQLNRLAAHP + ++ RT P LRSLNG Sbjct: 132 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNG 175 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,055,337 Number of Sequences: 59808 Number of extensions: 438782 Number of successful extensions: 8374 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5489 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -