BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1200 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 5e-15 SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 63 1e-10 SB_5072| Best HMM Match : Aldedh (HMM E-Value=2.4e-14) 46 3e-05 SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) 39 0.003 SB_19772| Best HMM Match : Aldedh (HMM E-Value=5.9e-12) 36 0.025 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 31 0.53 SB_58786| Best HMM Match : Aldedh (HMM E-Value=0) 29 2.2 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 29 2.9 SB_37963| Best HMM Match : Aldedh (HMM E-Value=1.8e-16) 28 5.0 SB_30441| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_52935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_18678| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 78.2 bits (184), Expect = 5e-15 Identities = 40/82 (48%), Positives = 49/82 (59%) Frame = +1 Query: 256 NPANGQVIAEVQHXXXXXXXXXXXXXXXXFKLGSPWRTMDASERGALINKLADLIERDRT 435 NP G+ I ++ FKLGS WRTMDAS RG L+ KLA LI+RD Sbjct: 351 NPTTGEKICDISEGDKEDVDKAVKAAKEAFKLGSAWRTMDASMRGKLLYKLAQLIDRDIA 410 Query: 436 YLASLETLDNGKPYKDSYFGDL 501 YLASLET+D+GK + DS GD+ Sbjct: 411 YLASLETIDSGKLFSDS-VGDM 431 >SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1485 Score = 63.3 bits (147), Expect = 1e-10 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = +1 Query: 343 FKLGSPWRTMDASERGALINKLADLIERDRTYLASLETLDNGK 471 FKLGS WRTMDAS RG + KLADL ERD YLA LE+ D GK Sbjct: 1250 FKLGSVWRTMDASARGHFLYKLADLCERDADYLARLESYDGGK 1292 >SB_5072| Best HMM Match : Aldedh (HMM E-Value=2.4e-14) Length = 266 Score = 45.6 bits (103), Expect = 3e-05 Identities = 27/78 (34%), Positives = 37/78 (47%) Frame = +1 Query: 238 EDLQN*NPANGQVIAEVQHXXXXXXXXXXXXXXXXFKLGSPWRTMDASERGALINKLADL 417 + +Q NPA +VIA V F SPW + ER L+ ADL Sbjct: 59 QTIQVLNPATAEVIARVPRAGQREIDRAVMAARQAFD-DSPWSRIKPVERQKLLWNFADL 117 Query: 418 IERDRTYLASLETLDNGK 471 IE++ LA +E++DNGK Sbjct: 118 IEKNAALLAEIESIDNGK 135 >SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) Length = 880 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/77 (25%), Positives = 35/77 (45%) Frame = +1 Query: 256 NPANGQVIAEVQHXXXXXXXXXXXXXXXXFKLGSPWRTMDASERGALINKLADLIERDRT 435 +P+ G + EV+ FK W + SERG ++ + L+ + R Sbjct: 297 DPSTGHISCEVKGSGKTEVKRAVLSARKAFKT---WSVLSGSERGRILGDASRLVRKRRE 353 Query: 436 YLASLETLDNGKPYKDS 486 +A +E DNGKP+ ++ Sbjct: 354 DIAKVEVHDNGKPFHEA 370 >SB_19772| Best HMM Match : Aldedh (HMM E-Value=5.9e-12) Length = 211 Score = 35.9 bits (79), Expect = 0.025 Identities = 18/29 (62%), Positives = 19/29 (65%) Frame = +1 Query: 445 SLETLDNGKPYKDSYFGDLYA**KTYGIY 531 SLETLDNGKPY DS+ DL K Y Y Sbjct: 32 SLETLDNGKPYNDSFNVDLEFTIKCYRYY 60 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 33.5 bits (73), Expect = 0.13 Identities = 21/72 (29%), Positives = 29/72 (40%) Frame = -2 Query: 399 DKGPPLGGVHCSPW*SKFERISSCLHSFVHICFVGMLDLSYNLAIGRVSVLKVFPSEDFT 220 D P + V C + I CLHSF C V L SY+ + V K P + Sbjct: 1359 DLNPHIICVLCGGYLVDATTIVECLHSFCRSCIVSWLQASYHCPVCDTEVHKTRPFLNIR 1418 Query: 219 HSLFMKRPVYKI 184 ++ VYK+ Sbjct: 1419 PDCVLQDIVYKL 1430 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 31.5 bits (68), Expect = 0.53 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -2 Query: 339 ISSCLHSFVHICFVGMLDLSYNLAIGRVSVLKVFPSEDFTHSLFMKRPVYKI 184 I CLHSF C V L+ SY + + K P + ++ VYK+ Sbjct: 29 IIECLHSFCRCCIVRYLETSYRCPVCDAEIHKTRPLLNIRADNVLQDIVYKV 80 >SB_58786| Best HMM Match : Aldedh (HMM E-Value=0) Length = 421 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 376 ASERGALINKLADLIERDRTYLASLETLDNGKPYKDSYFGDLYA 507 A ER ++ K DLI + +A + TL++GKP ++ LYA Sbjct: 4 AKERSIILRKWYDLILENIDDIAKIITLESGKPLLEARGEVLYA 47 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 339 ISSCLHSFVHICFVGMLDLSYNLAIGRVSVLKVFP 235 I CLHSF C V L+ SY + + K P Sbjct: 61 IIECLHSFCRCCIVRYLETSYRCPVCDAEIHKTRP 95 >SB_37963| Best HMM Match : Aldedh (HMM E-Value=1.8e-16) Length = 266 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/72 (27%), Positives = 27/72 (37%) Frame = +1 Query: 256 NPANGQVIAEVQHXXXXXXXXXXXXXXXXFKLGSPWRTMDASERGALINKLADLIERDRT 435 +P+ G+V +V FK W + R + KLADLIE Sbjct: 30 DPSRGEVYCKVPDSGKEHVDLAVAAANAAFK---SWSVSSPAYRAERLRKLADLIEDRLE 86 Query: 436 YLASLETLDNGK 471 A E+ D GK Sbjct: 87 EFAQAESRDQGK 98 >SB_30441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -1 Query: 556 WILSGPPGGRYRRFFIKHTDHRNTSPCMVCRCPASPG 446 W SGPPG R R F+ + + R SPG Sbjct: 10 WSSSGPPGRRNTRKFVDYAEKAKLRASAQARNSRSPG 46 >SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 76 YKYIKNVAERLQIGSGAKSEFCNSCFSGTGSPNKTGNFI---HRSLHK 210 +KY K++ + +++ K CN C S +K N + HR HK Sbjct: 166 FKYAKSLKQHIEVHCDPKRVKCNYCCIDLPSTSKLANRVVKRHRGEHK 213 >SB_52935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1333 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 200 LFINNEWVKSSDGKTFKT 253 LFIN E+V S GKTF T Sbjct: 711 LFINGEFVDSHHGKTFNT 728 >SB_18678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 397 INKLADLIERDRTYLASLETLDNGKP 474 +NKL D E+ + ++E +D+G+P Sbjct: 608 LNKLLDFEEKPTVFTVAIEVIDHGRP 633 >SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1931 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -1 Query: 544 GPPGGRYRRFFIKHTDHRNTSPCMVCRCPASPG*LNRFC 428 G G R R +++NT C C CP P L FC Sbjct: 1300 GATGRRCERCKAGFWNYKNTG-CQACNCPGGPENLWGFC 1337 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,010,457 Number of Sequences: 59808 Number of extensions: 402876 Number of successful extensions: 876 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -