BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1199 (506 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46170.1 68415.m05741 reticulon family protein (RTNLB5) weak ... 42 2e-04 At4g23630.1 68417.m03403 reticulon family protein (RTNLB1) weak ... 42 3e-04 At3g61560.1 68416.m06895 reticulon family protein (RTNLB6) conta... 41 4e-04 At5g41600.1 68418.m05054 reticulon family protein (RTNLB4) weak ... 39 0.002 At4g11220.1 68417.m01818 reticulon family protein (RTNLB2) simil... 36 0.012 At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak... 36 0.012 At3g10260.3 68416.m01230 reticulon family protein weak similarit... 36 0.021 At3g10260.2 68416.m01229 reticulon family protein weak similarit... 36 0.021 At3g10260.1 68416.m01228 reticulon family protein weak similarit... 36 0.021 At1g64090.1 68414.m07260 reticulon family protein (RTNLB3) weak ... 36 0.021 At2g15280.1 68415.m01742 reticulon family protein (RTNLB10) low ... 35 0.036 At4g01230.1 68417.m00162 reticulon family protein (RTNLB7) weak ... 34 0.063 At3g18260.1 68416.m02323 reticulon family protein (RTNLB9) weak ... 34 0.063 At1g70980.1 68414.m08188 asparaginyl-tRNA synthetase, cytoplasmi... 29 2.4 At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldol... 28 3.1 At3g10915.2 68416.m01315 reticulon family protein low similarity... 28 4.2 At3g10915.1 68416.m01314 reticulon family protein low similarity... 28 4.2 At3g12560.1 68416.m01563 telomeric DNA-binding protein, putative... 27 5.5 At3g21700.3 68416.m02737 expressed protein 27 9.6 At3g21700.2 68416.m02735 expressed protein 27 9.6 At3g21700.1 68416.m02736 expressed protein 27 9.6 >At2g46170.1 68415.m05741 reticulon family protein (RTNLB5) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon Length = 255 Score = 42.3 bits (95), Expect = 2e-04 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYEMNK 256 N A LR + L DL L V LW ++ VG FN +TL+ + ++ L T+P YE ++ Sbjct: 155 NQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLYEKHE 214 Query: 255 GRWTP 241 + P Sbjct: 215 DKVDP 219 >At4g23630.1 68417.m03403 reticulon family protein (RTNLB1) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon Length = 275 Score = 41.5 bits (93), Expect = 3e-04 Identities = 22/65 (33%), Positives = 32/65 (49%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYEMNK 256 N LR + DL L LW L+ +G CFN +TL + + LFT+P AY+ + Sbjct: 176 NRGFSSLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYE 235 Query: 255 GRWTP 241 + P Sbjct: 236 DKVDP 240 >At3g61560.1 68416.m06895 reticulon family protein (RTNLB6) contains Pfam profile PF02453: Reticulon Length = 253 Score = 41.1 bits (92), Expect = 4e-04 Identities = 22/67 (32%), Positives = 35/67 (52%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYEMNK 256 N A LR + L DL L LW ++ VG FN +TL+ + ++ L T+P YE ++ Sbjct: 155 NQAFVILRSIALGRDLKKFLMVVFGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHE 214 Query: 255 GRWTPTS 235 + P + Sbjct: 215 DKVDPVA 221 >At5g41600.1 68418.m05054 reticulon family protein (RTNLB4) weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251, SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 257 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N L LR + +D+ + LW L+ +G+C+N +TL + LFT+P YE Sbjct: 155 NRGLTLLRNIASGKDVKKFILVIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLYE 211 >At4g11220.1 68417.m01818 reticulon family protein (RTNLB2) similar to SP|Q64548 Reticulon 1 (Neuroendocrine-specific protein) {Rattus norvegicus}; contains Pfam profile PF02453: Reticulon Length = 271 Score = 36.3 bits (80), Expect = 0.012 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N + LR + D+ L LW L+ +G C++ +TL + + LFT+P Y+ Sbjct: 172 NRGISSLREIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYD 228 >At3g19460.1 68416.m02467 reticulon family protein (RTNLB11) weak similarity to neuroendocrine-specific protein C [Homo sapiens] GI:307311; identical to cDNA RTNLB11 GI:32331878 Length = 200 Score = 36.3 bits (80), Expect = 0.012 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 378 LKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 L+ ++LW ++YVG N +TL+ +G + + P YE Sbjct: 128 LQVSLVLWAISYVGTLINSLTLVYIGVLLSLSFPIVYE 165 >At3g10260.3 68416.m01230 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 267 Score = 35.5 bits (78), Expect = 0.021 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N L L+ L +L L + LW VG+C N +T++ +G++ T+P YE Sbjct: 168 NRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYE 224 >At3g10260.2 68416.m01229 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 247 Score = 35.5 bits (78), Expect = 0.021 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N L L+ L +L L + LW VG+C N +T++ +G++ T+P YE Sbjct: 148 NRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYE 204 >At3g10260.1 68416.m01228 reticulon family protein weak similarity to Nogo-C protein [Rattus norvegicus] GI:6822251; contains Pfam profile PF02453: Reticulon; identical to cDNA GI:32331854 Length = 247 Score = 35.5 bits (78), Expect = 0.021 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N L L+ L +L L + LW VG+C N +T++ +G++ T+P YE Sbjct: 148 NRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYE 204 >At1g64090.1 68414.m07260 reticulon family protein (RTNLB3) weak similarity to SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 255 Score = 35.5 bits (78), Expect = 0.021 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N LR + DL L LW L+ VG+ N +TLI + + LFT+P YE Sbjct: 151 NRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYE 207 >At2g15280.1 68415.m01742 reticulon family protein (RTNLB10) low similarity to neuroendocrine-specific protein C [Homo sapiens] GI:307311, SP|Q64548 Reticulon 1 (Neuroendocrine-specific protein) {Rattus norvegicus}; contains Pfam profile PF02453: Reticulon Length = 201 Score = 34.7 bits (76), Expect = 0.036 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N L R +++ + + V+LW +++VG N +T++ LG + +P YE Sbjct: 101 NTVLAVAREIYVGRNAKQLFRVSVVLWTVSFVGNFLNFLTILYLGVVLSLLIPFLYE 157 >At4g01230.1 68417.m00162 reticulon family protein (RTNLB7) weak similarity to SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 242 Score = 33.9 bits (74), Expect = 0.063 Identities = 15/57 (26%), Positives = 32/57 (56%) Frame = -3 Query: 435 NAALYELRRLFLVEDLVDSLKFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAYE 265 N A LR + L D+ + + + LW ++ +G F+ ++L+ + ++ + T+P YE Sbjct: 152 NCAFATLRSIALERDIKNFVMAVIGLWLVSVIGNWFSFLSLLYICFVLIHTVPMLYE 208 >At3g18260.1 68416.m02323 reticulon family protein (RTNLB9) weak similarity to RTN2-C [Homo sapiens] GI:3435090; contains Pfam profile PF02453: Reticulon Length = 225 Score = 33.9 bits (74), Expect = 0.063 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = -3 Query: 366 VLLWCLTYVGACFNGITLIILGWIALFTLPKAYEM 262 + L+ ++ +G FN + L+ +G++++ TLP YEM Sbjct: 149 ISLYIVSIIGTYFNFVNLLFIGFVSMQTLPVMYEM 183 >At1g70980.1 68414.m08188 asparaginyl-tRNA synthetase, cytoplasmic, putative / asparagine-tRNA ligase, putative similar to SYNC1 protein GI:5670315 [SP|Q9SW96] from [Arabidopsis thaliana] Length = 571 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -2 Query: 307 PRLDSAVHAAEGLRDEQGQVDANLELARAKINEITAKV 194 P ++ V AA + E+G+ A L++A+A EITA V Sbjct: 228 PPTEADVEAARLIVKERGEAVAQLKVAKASKEEITASV 265 >At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldolase, putative / 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase, putative / DAHP synthetase, putative similar to 3-deoxy-D-arabino-heptulosonate 7-phosphate GI:170224 from [Nicotiana tabacum], SP|P21357 from Solanum tuberosum; contains Pfam Class-II DAHP synthetase family domain PF01474 Length = 527 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 294 ALFTLPKAYEMNKGRWTPTSSWRAPRSTRSP 202 A T P + KG+W P SWR ++ + P Sbjct: 60 ATLTKPVGVNVGKGKWAP-ESWRTKKALQQP 89 >At3g10915.2 68416.m01315 reticulon family protein low similarity to rS-Rex-s [Rattus norvegicus] GI:1143717, neuroendocrine-specific protein C [Homo sapiens] GI:307311; contains Pfam profile PF02453: Reticulon Length = 226 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 375 KFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAY 268 K + LW L+ +G+ + TL+ +G I T+P Y Sbjct: 148 KVVICLWLLSAIGSYISLCTLLYIGTILSVTIPALY 183 >At3g10915.1 68416.m01314 reticulon family protein low similarity to rS-Rex-s [Rattus norvegicus] GI:1143717, neuroendocrine-specific protein C [Homo sapiens] GI:307311; contains Pfam profile PF02453: Reticulon Length = 220 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 375 KFGVLLWCLTYVGACFNGITLIILGWIALFTLPKAY 268 K + LW L+ +G+ + TL+ +G I T+P Y Sbjct: 142 KVVICLWLLSAIGSYISLCTLLYIGTILSVTIPALY 177 >At3g12560.1 68416.m01563 telomeric DNA-binding protein, putative similar to telomeric DNA-binding protein 1 [Arabidopsis thaliana] gi|13641340|gb|AAK31590 Length = 619 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 331 LQRDHAHHPRLDSAVHAAEGLRDEQGQVDANLEL 230 L A P LDS + A+ + D + VD+NLEL Sbjct: 426 LSERSAASPMLDSGIPHADDVIDSRNIVDSNLEL 459 >At3g21700.3 68416.m02737 expressed protein Length = 292 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 427 PV*AAQTVPGGGPGGLAEVRRAAVV 353 P+ A V GGG GG VRR++VV Sbjct: 66 PIPAVDVVVGGGGGGGEFVRRSSVV 90 >At3g21700.2 68416.m02735 expressed protein Length = 248 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 427 PV*AAQTVPGGGPGGLAEVRRAAVV 353 P+ A V GGG GG VRR++VV Sbjct: 66 PIPAVDVVVGGGGGGGEFVRRSSVV 90 >At3g21700.1 68416.m02736 expressed protein Length = 291 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 427 PV*AAQTVPGGGPGGLAEVRRAAVV 353 P+ A V GGG GG VRR++VV Sbjct: 66 PIPAVDVVVGGGGGGGEFVRRSSVV 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,604,931 Number of Sequences: 28952 Number of extensions: 104356 Number of successful extensions: 443 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -