BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1186 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 33 0.21 At2g39300.1 68415.m04825 expressed protein ; expression supporte... 27 7.9 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 7 PTAPEGQALVKPNGHGLFSQPRAPPKIKRPVPLSEKGKYE 126 P +P +L PN + F+QP PP I P PLS G ++ Sbjct: 95 PPSPPATSL-NPNSYSTFNQPPPPPTI-HPQPLSSYGSFD 132 >At2g39300.1 68415.m04825 expressed protein ; expression supported by MPSS Length = 768 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 61 SQPRAPPKIKRPVPLSEKGK 120 S+ R PP+ + P PLSE GK Sbjct: 134 SRRRLPPRAQSPSPLSESGK 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,284,938 Number of Sequences: 28952 Number of extensions: 228624 Number of successful extensions: 603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -