BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1177 (614 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 51 2e-05 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 40 0.062 UniRef50_A1D765 Cluster: Cyclin-like protein (Clg1), putative; n... 36 0.77 UniRef50_Q54U19 Cluster: Putative uncharacterized protein; n=1; ... 33 7.1 UniRef50_Q50D78 Cluster: Anti-Mullerian hormone; n=3; Danio reri... 32 9.4 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 51.2 bits (117), Expect = 2e-05 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +1 Query: 193 FLMLRWVDDLTAHLVLSGYWSHGHL 267 FL+LRWVD+LTAHLVLSGYWS HL Sbjct: 154 FLLLRWVDELTAHLVLSGYWSPRHL 178 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 39.5 bits (88), Expect = 0.062 Identities = 17/27 (62%), Positives = 20/27 (74%), Gaps = 3/27 (11%) Frame = +1 Query: 358 YCFTAEVGSR---WYLPARTHKRSYHQ 429 + F +GSR WYLPARTHKRSYH+ Sbjct: 559 HAFRRRLGSRAEWWYLPARTHKRSYHR 585 >UniRef50_A1D765 Cluster: Cyclin-like protein (Clg1), putative; n=9; Eurotiomycetidae|Rep: Cyclin-like protein (Clg1), putative - Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181)) Length = 475 Score = 35.9 bits (79), Expect = 0.77 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = -3 Query: 543 GFASFLCYVSSKWSAYVVILPEQKHHCIS*-NTVGTHSYLVVGPLVSPRG*VPP 385 GFAS+L + + W A V ++ HH ++ +T + ++V PL+SP G +PP Sbjct: 301 GFASWLSHWET-WRAKAVARAQESHHTLAPIDTNVSRGHMVSKPLLSPEGPIPP 353 >UniRef50_Q54U19 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 633 Score = 32.7 bits (71), Expect = 7.1 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +3 Query: 381 QPVVPTRADSQEVLPPDMNAFPLYFSLYSDVSVL 482 QP+ AD Q++L P NA PLY + YS+ S+L Sbjct: 420 QPIAS--ADDQQMLVPTANASPLYSNQYSEKSIL 451 >UniRef50_Q50D78 Cluster: Anti-Mullerian hormone; n=3; Danio rerio|Rep: Anti-Mullerian hormone - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 549 Score = 32.3 bits (70), Expect = 9.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 211 VDDLTAHLVLSGYWSHGHLQCKCATHLE 294 + + T L+++G WSHGH+ K T +E Sbjct: 190 ISEFTRFLIVTGGWSHGHIHLKLKTMVE 217 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,941,941 Number of Sequences: 1657284 Number of extensions: 11873073 Number of successful extensions: 25324 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25317 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 44392209541 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -