BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1176 (628 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2794| Best HMM Match : RNA_pol_Rpb5_C (HMM E-Value=7.2) 29 2.3 SB_56314| Best HMM Match : DUF454 (HMM E-Value=4.3) 28 7.1 >SB_2794| Best HMM Match : RNA_pol_Rpb5_C (HMM E-Value=7.2) Length = 371 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/85 (24%), Positives = 34/85 (40%) Frame = +2 Query: 317 TQNMPR*TCLLISDDYFITLIYEMILLQNQSYRLACKNHT*SRYYCLAKTFSHMIGAREK 496 T M TC I D + TL E++ + Y + +HT S K H + Sbjct: 117 TPEMWEKTCTCIKDIFKSTLPQELLTWRPDMYTMNAHDHTPSHSPTQTKFSDHELRPEHD 176 Query: 497 VERPSPCGRTGHNIAAACYLIIECI 571 + P G + + A L+I+C+ Sbjct: 177 IVPRHPDGSSAEELFTA--LLIKCV 199 >SB_56314| Best HMM Match : DUF454 (HMM E-Value=4.3) Length = 174 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 201 VIIGIIAYKLYLIKN--TSHLVIRLVKVDLPPALRLSFC 91 +++ +I +++K T H VI++ K PP +R+ FC Sbjct: 125 ILVAVILAACFIVKRVKTGHKVIKVTKTTPPPRIRI-FC 162 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,766,033 Number of Sequences: 59808 Number of extensions: 292193 Number of successful extensions: 475 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -