BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1176 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16200.1 68416.m02045 expressed protein 29 3.3 At3g46610.1 68416.m05060 pentatricopeptide (PPR) repeat-containi... 28 5.8 >At3g16200.1 68416.m02045 expressed protein Length = 452 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 175 FISNYAYNYLPI*KCSWLFLIKLTLIDFFHHSHSF 279 F+S + + P + LFL+ L LI HSHSF Sbjct: 60 FLSRIGHQWWPCLILALLFLVLLFLISVAFHSHSF 94 >At3g46610.1 68416.m05060 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 665 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 556 QVACSCYVVSCSTTRTRTLYFLSRTYHMAKSFS 458 ++ CSC+VVS TTR R + + + S S Sbjct: 22 ELDCSCFVVSPKTTRKRLCFLEQACFGSSSSIS 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,680,052 Number of Sequences: 28952 Number of extensions: 202675 Number of successful extensions: 314 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -