BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1174 (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) 31 0.59 SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) 29 4.1 SB_10056| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=7.7e-05) 28 7.2 SB_18056| Best HMM Match : Xan_ur_permease (HMM E-Value=0.96) 28 7.2 SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1) 28 7.2 SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) 27 9.6 SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) 27 9.6 SB_19088| Best HMM Match : PSGP (HMM E-Value=2.5) 27 9.6 >SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) Length = 958 Score = 31.5 bits (68), Expect = 0.59 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 35 SEVFSFLWASLTSISNDKAPRNILVERGRLELPGP 139 SE FLWA+L +ND+ R + GR P P Sbjct: 459 SECIKFLWAALAQFTNDERSRFLRFVTGRRRPPAP 493 >SB_25197| Best HMM Match : TatC (HMM E-Value=1.8) Length = 622 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVY 382 PSP +T YPS +LGN T + V+ Sbjct: 85 PSPNITSYPSLMTLKLGNFTTATSVVF 111 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVY 382 PSP +T YPS ELGN + + V+ Sbjct: 274 PSPNITSYPSLMTLELGNFTSATSVVF 300 >SB_10056| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=7.7e-05) Length = 1960 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQCDRL 412 PSP +T YPS + +GN + + V+ RL Sbjct: 843 PSPNITSYPSLTTSAVGNFTSATSVVFDSTTPNATRL 879 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQCDRL 412 PSP +T YPS + +GN + + V+ RL Sbjct: 1044 PSPNITSYPSLMKSAVGNFTSATSVVFDSTTPNATRL 1080 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQCDRL 412 PSP +T YPS + +GN + + V+ RL Sbjct: 1446 PSPNITSYPSLMTSAVGNFTSATSVVFDSTTPNATRL 1482 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQCDRL 412 PSP +T YPS + +GN + + V+ RL Sbjct: 1848 PSPNITSYPSLMTSAVGNFTSATSVVFDSTTPNATRL 1884 >SB_18056| Best HMM Match : Xan_ur_permease (HMM E-Value=0.96) Length = 651 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVY 382 PSP +T YPS LGN T + V+ Sbjct: 319 PSPNITSYPSLMTLALGNFTTATSVVF 345 >SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1) Length = 473 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVY 382 PSP + YPS ELGN T + V+ Sbjct: 4 PSPNIKSYPSLMTLELGNFTTATSVVF 30 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVY 382 PSP + YPS ELGN T + V+ Sbjct: 382 PSPNIKSYPSLMTLELGNFTTATSVVF 408 >SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) Length = 569 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 307 PEINALPELRRQRIRQLSNRTDYCIQGQSRP 399 PE++A PE +RQ RQLS + Q P Sbjct: 325 PEVDATPEFKRQFSRQLSISRQFSRQDSITP 355 >SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) Length = 392 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 334 RRQRIRQLSNRTDYCIQGQSRPV*SSLGIRRWHLWIPTTLQMCARTR-SMY 483 RR R+R + + Y + P S+LG W+++ L MC T SMY Sbjct: 231 RRNRVRMGKDLSSYSTVNRGCPQGSALGPLLWNIF-QNDLPMCVNTELSMY 280 >SB_19088| Best HMM Match : PSGP (HMM E-Value=2.5) Length = 737 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 302 PSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQCDRL 412 PSP +T YPS + +GN + + V+ RL Sbjct: 150 PSPNITSYPSLMTSAVGNFTSATSVVFDSTTPNATRL 186 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,181,869 Number of Sequences: 59808 Number of extensions: 435825 Number of successful extensions: 1237 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1235 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -