BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1169 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1732 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 131 ETLDDLTKDPLSTDCFFSLLPTPSVPSRSHE 223 + D+T+ P+ T F ++ PS P R HE Sbjct: 1035 QVFGDMTEVPIPTRFIFIMMGPPSTPGRYHE 1065 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +2 Query: 59 KFIAVFGLVIILNLSDKLFDGNLIETLDDLTKDPLSTDCFFSLLPTPSVPS 211 K + ++G V ++D+L +IE L LTK SLL PS+ S Sbjct: 1717 KSLELYGDVFSSGVADRLSQNTVIEKLKILTKQENKAVISTSLLQNPSLKS 1767 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,378,219 Number of Sequences: 59808 Number of extensions: 316394 Number of successful extensions: 808 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -