BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1165 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 29 2.7 At2g16400.1 68415.m01877 homeodomain-containing protein 27 8.1 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/70 (22%), Positives = 31/70 (44%) Frame = +3 Query: 48 PLGFHFHASWLKSKKEYRDELIKFIEEMLEKNDVYFTSLIQVIQWMQNPTELSSLRDFQE 227 P+ + ASW + + +L K E + Y+ + +V Q + +S + Q Sbjct: 120 PIIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTIQL 179 Query: 228 WKQDKCDVKV 257 WK+D+ +V Sbjct: 180 WKEDEMKEEV 189 >At2g16400.1 68415.m01877 homeodomain-containing protein Length = 482 Score = 27.5 bits (58), Expect = 8.1 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 3/89 (3%) Frame = +3 Query: 141 NDVYFTSLIQVIQWMQNPTELSSLRDFQEWKQDKCDVKVNLSVLCRTPVH*QLESYQ--- 311 N+V + IQV+ + +++ ++D W+ + + + V+ R + Q+E+ + Sbjct: 40 NNVSPSKEIQVLSSLGGVSQMVEIQDSGSWRDQEDNDRNRFPVMRRLGLSSQIETSRGNN 99 Query: 312 ERHYVFSLVWSVLTTIHGSWILRAKDTTL 398 Y +V TIH S L+A L Sbjct: 100 NNEYATQVVSGFTRTIHNSKYLKAAQELL 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,623,013 Number of Sequences: 28952 Number of extensions: 266460 Number of successful extensions: 696 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -