BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-1930
(460 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 1.2
AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 1.2
AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.5
>DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related
protein STG-1 protein.
Length = 397
Score = 23.4 bits (48), Expect = 1.2
Identities = 6/7 (85%), Positives = 6/7 (85%)
Frame = +2
Query: 389 SCCPWCC 409
SCC WCC
Sbjct: 10 SCCCWCC 16
>AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation
factor 2 protein.
Length = 690
Score = 23.4 bits (48), Expect = 1.2
Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%)
Frame = +3
Query: 87 KDYHAPKHTELEKI--PNLQVIKAMQSLKSRGYVKEQ 191
KD P + KI PN+ +IK L G V E+
Sbjct: 242 KDAKVPIIVAINKIDKPNIDIIKVQYELAKHGIVIEE 278
>AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1
protein.
Length = 500
Score = 20.6 bits (41), Expect = 8.5
Identities = 6/13 (46%), Positives = 9/13 (69%)
Frame = -2
Query: 417 HEVQHQGQQEYVC 379
H+V H G++ Y C
Sbjct: 250 HQVAHYGEKVYKC 262
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,127
Number of Sequences: 438
Number of extensions: 2073
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12189771
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -