SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-1930
         (460 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    23   1.2  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    23   1.2  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    21   8.5  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 23.4 bits (48), Expect = 1.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +2

Query: 389 SCCPWCC 409
           SCC WCC
Sbjct: 10  SCCCWCC 16


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 23.4 bits (48), Expect = 1.2
 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%)
 Frame = +3

Query: 87  KDYHAPKHTELEKI--PNLQVIKAMQSLKSRGYVKEQ 191
           KD   P    + KI  PN+ +IK    L   G V E+
Sbjct: 242 KDAKVPIIVAINKIDKPNIDIIKVQYELAKHGIVIEE 278


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 20.6 bits (41), Expect = 8.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -2

Query: 417 HEVQHQGQQEYVC 379
           H+V H G++ Y C
Sbjct: 250 HQVAHYGEKVYKC 262


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,127
Number of Sequences: 438
Number of extensions: 2073
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12189771
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -