BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0885 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 1.5 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 24 1.5 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 3.4 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 6.0 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 8.0 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 174 HPDSQLFSCSKCTYT 130 H S+ F C+KC YT Sbjct: 253 HAGSKPFQCNKCDYT 267 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 174 HPDSQLFSCSKCTYT 130 H S+ F C+KC YT Sbjct: 11 HAGSKPFQCNKCDYT 25 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +1 Query: 589 CRVPLITSQKEEQLLIMSTSKPVVKLLINRHNNKYSYTSTSDDNLLKNIEL 741 C P+I + + ++L KLLIN + Y++ + ++ + ++L Sbjct: 93 CSAPIIITILDIEILGYVNKAKFGKLLINLYTINYNFKESERNDYVSLLQL 143 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 166 LSTIFLFQMYLYYILCSFNTI 104 L + FQMY +I+ +FN++ Sbjct: 429 LYAVEYFQMYAQFIVGTFNSV 449 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 662 FTTGLEVDIIKSCSSFCEVIK 600 F T LE+ +CS +C V K Sbjct: 266 FNTVLELMPKHACSEYCRVFK 286 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,281 Number of Sequences: 336 Number of extensions: 3638 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -