BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0883 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04390.1 68414.m00429 expressed protein 29 3.9 At3g29300.1 68416.m03678 hypothetical protein 28 6.8 >At1g04390.1 68414.m00429 expressed protein Length = 849 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 199 LLYALVPLCSLVNHSHYG 146 LLYAL+ L LVNHS +G Sbjct: 442 LLYALLALAELVNHSFFG 459 >At3g29300.1 68416.m03678 hypothetical protein Length = 213 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = -2 Query: 477 LAFTSVFDCITELICPIVLTKRRYNNLSKRITALIT 370 + + V + EL C ++L +RR+N+L+ IT ++ Sbjct: 13 MVLSLVLVLLAELYCSLLLRRRRHNSLNLPITTTVS 48 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,917,303 Number of Sequences: 28952 Number of extensions: 241859 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -