BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0875 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 26 0.27 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 26 0.27 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 24 1.4 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 7.7 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 7.7 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 26.2 bits (55), Expect = 0.27 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 645 FINVTRKREMTSFWHLSSVLYHQD 716 FIN R++ S W++++VL HQ+ Sbjct: 373 FINNLTDRKLLSAWYMNTVLGHQN 396 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 26.2 bits (55), Expect = 0.27 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 645 FINVTRKREMTSFWHLSSVLYHQD 716 FIN R++ S W++++VL HQ+ Sbjct: 265 FINNLTDRKLLSAWYMNTVLGHQN 288 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +3 Query: 258 GYNWRRICGLRSSS---DESIWRSTCAQGP 338 G+ W GL + S D+ WRS C Q P Sbjct: 313 GWQWGPDAGLGNLSVCIDQQPWRSYCIQPP 342 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 37 SDSHPEGVGMEPRAIHPGMKFSIT 108 S +HP M P +H GM S+T Sbjct: 362 SHAHPMHHDMLPETMHMGMGPSLT 385 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 37 SDSHPEGVGMEPRAIHPGMKFSIT 108 S +HP M P +H GM S+T Sbjct: 362 SHAHPMHHDMLPETMHMGMGPSLT 385 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,356 Number of Sequences: 336 Number of extensions: 4247 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -