BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0875 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23660.2 68417.m03407 UbiA prenyltransferase family protein s... 32 0.34 At4g23660.1 68417.m03406 UbiA prenyltransferase family protein s... 32 0.34 At5g48910.1 68418.m06051 pentatricopeptide (PPR) repeat-containi... 31 0.59 At2g29000.1 68415.m03527 leucine-rich repeat family protein / pr... 31 0.78 At5g41040.2 68418.m04989 transferase family protein similar to h... 29 2.4 At5g41040.1 68418.m04988 transferase family protein similar to h... 29 2.4 At5g13690.1 68418.m01594 alpha-N-acetylglucosaminidase family / ... 29 4.2 At3g57070.1 68416.m06354 glutaredoxin family protein contains Pf... 29 4.2 At2g25150.1 68415.m03008 transferase family protein similar to 1... 29 4.2 At5g50390.1 68418.m06241 pentatricopeptide (PPR) repeat-containi... 28 5.5 At5g38970.3 68418.m04714 cytochrome P450, putative similar to Cy... 28 5.5 At5g38970.2 68418.m04712 cytochrome P450, putative similar to Cy... 28 5.5 At5g38970.1 68418.m04713 cytochrome P450, putative similar to Cy... 28 5.5 At5g15340.1 68418.m01796 pentatricopeptide (PPR) repeat-containi... 28 7.3 At1g07060.1 68414.m00752 expressed protein 28 7.3 At3g22690.1 68416.m02863 pentatricopeptide (PPR) repeat-containi... 27 9.6 >At4g23660.2 68417.m03407 UbiA prenyltransferase family protein similar to para-hydroxybenzoate--polyprenyltransferase, mitochondrial [Precursor] [Saccharomyces cerevisiae], SP|P32378; contains PF01040 UbiA prenyltransferase family domain Length = 407 Score = 32.3 bits (70), Expect = 0.34 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Frame = +3 Query: 204 WEGGRKIHSRGRYLPRE----IGYNWRRICGLRSSS 299 W ++ S+GR L +E +G+N+R ICG+ SSS Sbjct: 55 WNDNYQVWSKGRELHQEKFFGVGWNYRLICGMSSSS 90 >At4g23660.1 68417.m03406 UbiA prenyltransferase family protein similar to para-hydroxybenzoate--polyprenyltransferase, mitochondrial [Precursor] [Saccharomyces cerevisiae], SP|P32378; contains PF01040 UbiA prenyltransferase family domain Length = 407 Score = 32.3 bits (70), Expect = 0.34 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Frame = +3 Query: 204 WEGGRKIHSRGRYLPRE----IGYNWRRICGLRSSS 299 W ++ S+GR L +E +G+N+R ICG+ SSS Sbjct: 55 WNDNYQVWSKGRELHQEKFFGVGWNYRLICGMSSSS 90 >At5g48910.1 68418.m06051 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 646 Score = 31.5 bits (68), Expect = 0.59 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 61 GMEPRAIHPGMKFSITGNGGLLGEASVFRADLP 159 G+EPR H G + G GLL EA F ++P Sbjct: 406 GLEPRIEHYGCMVDLLGRSGLLDEAEEFILNMP 438 >At2g29000.1 68415.m03527 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 872 Score = 31.1 bits (67), Expect = 0.78 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -2 Query: 570 DRLAFDGAF-VAPGGCLSDTVTIAKRALSQVLLHHSSTEGDLRFWVESELSLRV 412 +R+ +G F + G L+DT +A + LS HSST+G +F E EL LRV Sbjct: 568 ERVIGEGGFGIVYHGHLNDTEQVAVKLLS-----HSSTQGYKQFKAEVELLLRV 616 >At5g41040.2 68418.m04989 transferase family protein similar to hypersensitivity-related gene product HSR201 - Nicotiana tabacum, EMBL:X95343; contains Pfam transferase family domain PF00248 Length = 441 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 519 DTVTIAKRALSQVLLHHSSTEGDLRFWVESELSLRVGEQQV 397 + V + K+ALSQVL+H+ G L E +L++ E+ V Sbjct: 64 EAVQVIKKALSQVLVHYYPLAGRLTISPEGKLTVDCTEEGV 104 >At5g41040.1 68418.m04988 transferase family protein similar to hypersensitivity-related gene product HSR201 - Nicotiana tabacum, EMBL:X95343; contains Pfam transferase family domain PF00248 Length = 457 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 519 DTVTIAKRALSQVLLHHSSTEGDLRFWVESELSLRVGEQQV 397 + V + K+ALSQVL+H+ G L E +L++ E+ V Sbjct: 80 EAVQVIKKALSQVLVHYYPLAGRLTISPEGKLTVDCTEEGV 120 >At5g13690.1 68418.m01594 alpha-N-acetylglucosaminidase family / NAGLU family contains Pfam profile: PF05089 alpha-N-acetylglucosaminidase (NAGLU) Length = 806 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/56 (33%), Positives = 22/56 (39%) Frame = -2 Query: 351 SGLTWVLAHKCYARYFHQMNFGVHRSAASCSQFHVASNVHVNVFFYRLPTGPWNVY 184 SGL W L +KC A G+ AS Q + F R P PWN Y Sbjct: 107 SGLHWYLKYKCNAHVSWDKTGGI--QVASVPQPGHLPRIDSKRIFIRRPV-PWNYY 159 >At3g57070.1 68416.m06354 glutaredoxin family protein contains Pfam profile PF00462: Glutaredoxin Length = 417 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = -3 Query: 290 SESTDPPPVVANFTWQVTST*MYFSTAFPRVPGTSTYSVFSST*GRSARKT 138 S S++P +++ V+S+ + S A PR+PGT V T R RKT Sbjct: 233 SPSSNPSILISEEPKSVSSSQLISSPAKPRLPGTEDKIVLYFTTLRGIRKT 283 >At2g25150.1 68415.m03008 transferase family protein similar to 10-deacetylbaccatin III-10-O-acetyl transferase [gi:6746554], 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase [gi:11559716] from Taxus cuspidata; contains Pfam transferase family domain PF00248; contains EST gb:R65039 Length = 461 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -2 Query: 546 FVAPGGCLSDTVTIAKRALSQVLLHHSSTEGDL 448 F A G L D V++ ++ALS++L+H+ G L Sbjct: 53 FKANGKNLDDPVSLLRKALSELLVHYYPLSGKL 85 >At5g50390.1 68418.m06241 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 701 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 61 GMEPRAIHPGMKFSITGNGGLLGEASVF 144 G++PRA+H + G GLL EA F Sbjct: 457 GIKPRAMHYACMIELLGRDGLLDEAIAF 484 >At5g38970.3 68418.m04714 cytochrome P450, putative similar to Cytochrome P450 85 (SP:Q43147) {Lycopersicon esculentum}; Length = 419 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -1 Query: 205 HGSLERLHILSFPRLEVGQLGKHWLHPKDPHFL*Y*ISFLDEWRVVPCLHLQDASR 38 HGS RL S L + + + PK HF+ S+LD+W + + +QD ++ Sbjct: 119 HGSSHRLMRGSLLSLISSTMMRDHILPKVDHFM---RSYLDQWNELEVIDIQDKTK 171 >At5g38970.2 68418.m04712 cytochrome P450, putative similar to Cytochrome P450 85 (SP:Q43147) {Lycopersicon esculentum}; Length = 384 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -1 Query: 205 HGSLERLHILSFPRLEVGQLGKHWLHPKDPHFL*Y*ISFLDEWRVVPCLHLQDASR 38 HGS RL S L + + + PK HF+ S+LD+W + + +QD ++ Sbjct: 38 HGSSHRLMRGSLLSLISSTMMRDHILPKVDHFM---RSYLDQWNELEVIDIQDKTK 90 >At5g38970.1 68418.m04713 cytochrome P450, putative similar to Cytochrome P450 85 (SP:Q43147) {Lycopersicon esculentum}; Length = 465 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -1 Query: 205 HGSLERLHILSFPRLEVGQLGKHWLHPKDPHFL*Y*ISFLDEWRVVPCLHLQDASR 38 HGS RL S L + + + PK HF+ S+LD+W + + +QD ++ Sbjct: 119 HGSSHRLMRGSLLSLISSTMMRDHILPKVDHFM---RSYLDQWNELEVIDIQDKTK 171 >At5g15340.1 68418.m01796 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 623 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 61 GMEPRAIHPGMKFSITGNGGLLGEASVFRADLP 159 G+EP+ H + G GL+ EA + ++P Sbjct: 381 GLEPKVDHYACMVDLLGRAGLIEEAEILMREMP 413 >At1g07060.1 68414.m00752 expressed protein Length = 233 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +2 Query: 416 LRLSSLSTQNLKSPSVLEW*SSTCDSARFAIVTVSLKHPPGATKAPSNA 562 +R +L+ + LKSPS L S + +FA+ ++ P A KA NA Sbjct: 121 MRYEALNLRQLKSPSCLWLGVSHSEWTKFAVQSMENGFPSIAGKASENA 169 >At3g22690.1 68416.m02863 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 978 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 61 GMEPRAIHPGMKFSITGNGGLLGEASVFRADLP 159 G+ P +H G + G GLL EA D+P Sbjct: 602 GVSPEDVHYGCMVDLLGRAGLLEEAVQLIEDMP 634 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,986,316 Number of Sequences: 28952 Number of extensions: 378284 Number of successful extensions: 892 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -