BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0872 (791 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) 29 3.3 SB_38076| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) 28 10.0 >SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) Length = 765 Score = 29.5 bits (63), Expect = 3.3 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 94 VRTSEIEYPEPGQQNFAYISAIYVKDHYTDGNGGYPIVK-SGGVGQKFVKLKLKSQRG 264 +R+S E P PGQ + +S+ VKD N G + SG + Q + LKS +G Sbjct: 499 LRSSSTETPHPGQSKPSLLSSQLVKDPPQSANTGKIMQSLSGFIVQASLHACLKSVKG 556 >SB_38076| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) Length = 577 Score = 27.9 bits (59), Expect = 10.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 504 INTFNIFIPYLVSCVI 551 +N FNIF+ YL++C + Sbjct: 152 VNVFNIFVKYLIACTL 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,034,633 Number of Sequences: 59808 Number of extensions: 364159 Number of successful extensions: 684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -