BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0871 (400 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 1.9 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 2.6 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 22.2 bits (45), Expect = 1.9 Identities = 16/57 (28%), Positives = 24/57 (42%) Frame = -1 Query: 253 TLLPYLYIGTLLQITCKKSYT*KYKFELTFTLSRTLKNSHTDQLYRSGAQRYYLRVT 83 T + L IG Q+ C+ S L LSR + + + G + YY+ VT Sbjct: 450 TFITLLTIGLYFQL-CEFSRLNFSVEHLLMELSRAIDSVACSKTVSDGIRHYYVNVT 505 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.8 bits (44), Expect = 2.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 241 YLYIGTLLQITCKKSY 194 +LYI T L +TC +Y Sbjct: 136 FLYIFTYLSVTCYVTY 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,607 Number of Sequences: 336 Number of extensions: 1045 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -