BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0870 (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 309 1e-84 SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 30 1.3 SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_11242| Best HMM Match : MAM (HMM E-Value=0) 29 3.9 SB_4005| Best HMM Match : CAP_GLY (HMM E-Value=5.8e-17) 29 3.9 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 309 bits (758), Expect = 1e-84 Identities = 139/184 (75%), Positives = 161/184 (87%) Frame = +2 Query: 2 LNAPKHGMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVKQRLIK 181 LNAPKH MLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G EV KIVKQRLIK Sbjct: 436 LNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEEVKKIVKQRLIK 495 Query: 182 VDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVAT 361 +DGKVRTD TYPAGFMDVV+I+KT E FRL+YDVKGRF +HRIT EEAKYKL +V+RV Sbjct: 496 IDGKVRTDTTYPAGFMDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAKYKLGRVRRVDV 555 Query: 362 GPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGR 541 G K VPY+VTHD RTIRYPDP IKVND++ +DI T K++D+IKF++GN+ M+ GGRN+GR Sbjct: 556 GAKGVPYIVTHDARTIRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTGNMAMVVGGRNMGR 615 Query: 542 VGTI 553 VG + Sbjct: 616 VGMV 619 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +3 Query: 561 RERHAGXFDIVHIKD 605 RE+HAG FDIVH+KD Sbjct: 622 REKHAGSFDIVHVKD 636 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/72 (23%), Positives = 35/72 (48%) Frame = +2 Query: 299 IHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIM 478 I +TP+ K C+V R++TGP +++ +G + +++ ++ + + + Sbjct: 287 IRMVTPQGTVEKSCQVPRMSTGPDLHHFIMGSEGTLGVITEVTLRIRPVPEIRVYGSVV- 345 Query: 479 DFIKFESGNLCM 514 F FE G CM Sbjct: 346 -FPDFEKGVACM 356 >SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1776 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/56 (19%), Positives = 28/56 (50%) Frame = +2 Query: 125 KYALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGR 292 +Y L ++ + + L++ G + P+YP+ ++ ++ +N+LF + R Sbjct: 596 EYWLMASQGQHVSESTLVRGRGDILISPSYPSALLETTTLITSNQLFNTFIESSTR 651 >SB_11242| Best HMM Match : MAM (HMM E-Value=0) Length = 348 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = +1 Query: 112 EES--SEVCFDRKRSPENCE 165 EES +E+C DRKR P++CE Sbjct: 76 EESRYNELCHDRKRGPDDCE 95 >SB_4005| Best HMM Match : CAP_GLY (HMM E-Value=5.8e-17) Length = 560 Score = 28.7 bits (61), Expect = 3.9 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 3/102 (2%) Frame = +2 Query: 11 PKHGMLDKLGGVYAPRPSTGPHKLRECLP-LVIFLRNRLKYALTGNEVLKIVKQRLI--K 181 PKHG+ + G V+ K E P ++F++ R+K L G + ++V++ + Sbjct: 138 PKHGLFARPGVVHPHSDVDMISKTSEISPNAIVFIQTRMKRMLAGMRLRRLVERSGFERE 197 Query: 182 VDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHR 307 +D V+ P ++ +S + E F D + F I+R Sbjct: 198 IDKHVQNTPASATASINQLS-DYLTECFST--DREKAFAIYR 236 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 28.3 bits (60), Expect = 5.1 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 6/95 (6%) Frame = +2 Query: 317 EEAKYKLCKVKRVATGPKNVPYLVTHDG---RTIRYPDPLIKVNDSIQLDIATTKIMDFI 487 E+A +C++ R+ P+ LV G +++ I + Q+ + + + Sbjct: 2971 EDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDM 3030 Query: 488 KFESGNLCMITGGRNLGRVGTI---RVPRETCRLL 583 K + NLC G +N+G V + +VP E +L Sbjct: 3031 KLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVL 3065 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%) Frame = -2 Query: 189 PSTFMRRCFTIFRTSFPVKAYFRRFLRK------ITRGKHSRNLW 73 PS++ F +FRT FP + RF R+ IT ++LW Sbjct: 84 PSSYNGHQFLVFRTDFPFSKHKNRFKRRTKYLYVITTSTKHQHLW 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,892,516 Number of Sequences: 59808 Number of extensions: 446929 Number of successful extensions: 1143 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1061 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1143 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -