BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0861 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 2.2 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 6.7 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.8 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 8.8 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 8.8 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 374 QAISQAFTREYGRDLIEDLKSELGGHFEDVIVAL 475 Q Q F E R L+EDL++E + DV+V + Sbjct: 140 QEFIQIFNEETKR-LVEDLEAECHKPYIDVVVPI 172 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 545 LHPCPY--PPCNGAAPGTGTPQGESSE 471 L P PY P + AAP T + + +SSE Sbjct: 108 LRPHPYLSPLFHSAAPRTASRETKSSE 134 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 499 QVLLRGSHQSHDYIFEVTTQ 440 ++LLR + H + F TT+ Sbjct: 198 EILLRNGEKHHSFPFRKTTE 217 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 277 YGIEVRHSYYSWSSLIGH 224 Y I VRH+YY I H Sbjct: 60 YSIYVRHTYYRRLYTITH 77 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 277 YGIEVRHSYYSWSSLIGH 224 Y I VRH+YY I H Sbjct: 60 YSIYVRHTYYRRLYTITH 77 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,755 Number of Sequences: 336 Number of extensions: 3567 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -